KEGG   Rattus norvegicus (rat): 24875
Entry
24875             CDS       T01003                                 

Gene name
Vipr1, PACAP-R-2, PACAP-R2, RATVASREC, RGD1564352, VASREC, VIP-R-1
Definition
(RefSeq) vasoactive intestinal peptide receptor 1
  KO
K04589  vasoactive intestinal peptide receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24875 (Vipr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24875 (Vipr1)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    24875 (Vipr1)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 24875
NCBI-ProteinID: NP_036817
RGD: 3961
UniProt: P30083
Position
8q32
AA seq 459 aa
MRPPSPPHVRWLCVLAGALACALRPAGSQAASPQHECEYLQLIEIQRQQCLEEAQLENET
TGCSKMWDNLTCWPTTPRGQAVVLDCPLIFQLFAPIHGYNISRSCTEEGWSQLEPGPYHI
ACGLNDRASSLDEQQQTKFYNTVKTGYTIGYSLSLASLLVAMAILSLFRKLHCTRNYIHM
HLFMSFILRATAVFIKDMALFNSGEIDHCSEASVGCKAAVVFFQYCVMANFFWLLVEGLY
LYTLLAVSFFSERKYFWGYILIGWGVPSVFITIWTVVRIYFEDFGCWDTIINSSLWWIIK
APILLSILVNFVLFICIIRILVQKLRPPDIGKNDSSPYSRLAKSTLLLIPLFGIHYVMFA
FFPDNFKAQVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWSSKS
QHPWGGSNGATCSTQVSMLTRVSPSARRSSSFQAEVSLV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcgccctccgagcccaccgcatgtccgctggctctgcgtgctggcaggagcccttgcc
tgcgccctcagacccgcgggcagccaggcagccagcccgcagcacgagtgtgagtacctg
cagttgattgagatacagcgtcagcagtgcctggaggaggcccagctggagaatgaaacc
acaggctgcagcaagatgtgggacaacctcacctgctggccgacaaccccgaggggccag
gcggtagtcctggactgccccctcatctttcagctgtttgcccccattcatggttataac
atcagccgtagctgcactgaagagggctggtcacaactggaaccaggcccctaccacatt
gcctgcggcctgaatgacagggcatcgagtctggatgagcagcaacagaccaagttctac
aataccgtgaagaccggctacaccatcggctacagcttgtcccttgccagcctcctggtt
gccatggctatcttgagcctgttcaggaagctgcactgtacccgaaactacatccacatg
catctcttcatgtccttcatcctgagggccactgccgtcttcatcaaggatatggccctc
ttcaacagcggggagatagaccactgctctgaggcctcggtggggtgcaaggcagcggtg
gttttcttccagtattgtgtcatggccaacttcttctggctgctggtagagggcctctac
ctatacaccctgctggccgtctccttcttctccgagcggaagtacttctgggggtacatt
ctcatcggctggggagtgcccagtgtgttcatcaccatatggacggtcgtcaggatatat
tttgaggatttcgggtgctgggacaccatcatcaactcctccctgtggtggatcataaag
gcccccatcctcctctccatcctggtgaacttcgtcctgtttatctgcatcatccggatc
ctggttcagaaactacggccacccgacattgggaagaatgatagcagcccatattcgagg
ctggccaagtccacgcttctgctcatccccctgtttggaattcactatgtcatgtttgcc
ttcttccccgacaacttcaaggcccaggtgaaaatggtcttcgaacttgtcgtgggctct
ttccagggtttcgtggtggccatcctctactgcttcctcaatggtgaggtgcaggcggag
ctgcggcggaagtggcggcgttggcatctgcagggcgtcctgggctggagctccaaatcc
cagcatccgtggggaggcagcaacggcgccacatgcagcacgcaggtatccatgctgacc
cgcgtcagcccgagcgcacgccgctcctccagcttccaagcggaggtctccctggtctga

DBGET integrated database retrieval system