KEGG   Rattus norvegicus (rat): 24886Help
Entry
24886             CDS       T01003                                 

Gene name
Tbxas1
Definition
(RefSeq) thromboxane A synthase 1
  KO
K01832  thromboxane-A synthase [EC:5.3.99.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    24886 (Tbxas1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24886 (Tbxas1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    24886 (Tbxas1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.5  thromboxane-A synthase
     24886 (Tbxas1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP5 family
   24886 (Tbxas1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 24886
NCBI-ProteinID: NP_036819
RGD: 3826
Ensembl: ENSRNOG00000007918
UniProt: P49430
Position
4q22
AA seq 533 aa AA seqDB search
MEVLGLLKFEVSGTVVTVTLSVVLLALLKWYSTSAFSRLRKLGIRHPEPSPFVGNLMFFR
QGFWESHLELRERYGPLCGYYLGRRMYIVISDPDMIKEVLVENFSNFSNRMASGLEPKLI
ADSVLMLRDRRWEEVRGALMSAFSPEKLNEMTPLISQACELLLSHLKHSAASGDAFDIQR
CYCCFTTNVVASVAFGIEVNSQDAPEDPFVQHCQRVFAFSTPRPLLALILSFPSIMVPLA
RILPNKNRDELNGFFNTLIRNVIALRDKQTAEERRGDFLQMVLDAQRSMSSVGVEAFDMV
TEALSSAECMGDPPQRCHPTSTAKPLTVDEIAGQAFLFLIAGHEITTNTLSFITYLLATH
PECQERLLKEVDLFMEKHPAPEYCNLQEGLPYLDMVVAETLRMYPPAFRFTREAAQDCEV
LGQHIPAGSVLEIAVGALHHDPEHWPNPETFDPERFTAEARLQQKPFTYLPFGAGPRSCL
GVRLGLLVVKLTLLQVLHKFRFEACPETQVPLQLESKSALCPKNGVYVKIVSR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgttggggcttctcaagttcgaagtcagtggtaccgtagtgactgtgactctg
tccgtggttctcttggccctcctgaaatggtactccacatcagcgttctcaagactgagg
aagttgggcatcagacaccctgagccttctccttttgttggaaacttgatgtttttccgc
cagggcttttgggagagccatttggagctccgagagcgatatgggcctctgtgtgggtac
tatcttggccgtcggatgtacattgtcatttcagacccagacatgatcaaggaggtgttg
gttgagaacttcagtaacttttccaacagaatggcctcaggtctggaacccaagctgata
gcagacagtgtcctgatgttacgtgacagaagatgggaggaagtcagaggtgccctgatg
tctgcattcagtcctgaaaaattgaacgagatgacacctctcatcagccaagcctgtgaa
cttctcctgtctcacttaaaacactctgcggcatccggggacgcattcgacatccagagg
tgttactgctgttttaccacaaatgtggtggccagtgtggcctttggcatcgaggtgaac
tcccaggatgctccagaagacccctttgtgcaacactgccagcgtgtttttgctttcagt
accccaaggcctctcctggctttaattttatcatttccatccataatggtcccattggcc
cggattctgcccaataagaaccgagatgaactgaatggcttttttaacacactcattagg
aatgtgattgccttacgggacaagcaaacagcagaagagaggcggggagacttcctgcag
atggtgctggatgcccagcgttccatgagctctgtgggtgtagaagcctttgacatggtc
acagaagccctgtcctctgctgagtgcatgggggacccaccccaaaggtgtcatcctaca
tccacagctaagcctttaactgtggatgagattgccggccaggctttcctcttcctcatc
gctggccacgagatcaccacaaacacgctctccttcatcacatacctgctggccacccac
cctgagtgccaggagaggcttctgaaagaggtggacctcttcatggagaagcatccagcc
cctgagtactgcaacctgcaggaaggtctgccctatctggacatggtggttgcagagacc
ctgaggatgtacccaccagctttcagattcacaagggaggcagcacaggactgtgaggtg
ctgggacagcacatccctgcaggttctgtgctggagattgctgtgggtgccctacaccat
gacccagagcactggccgaaccctgagacctttgaccctgaaaggtttacagcagaagcc
cggcttcagcagaagccattcacatacctgccttttggagctggtcccaggagctgcctt
ggagtacggctggggctgctggtggtcaagctgacactgctccaggtcctacacaagttc
cgctttgaagcttgccctgagactcaggttccacttcagctagaatccaaatctgctcta
tgccccaaaaatggagtctacgtcaagattgtgtcacgctga

DBGET integrated database retrieval system