KEGG   Rattus norvegicus (rat): 24888
Entry
24888             CDS       T01003                                 

Gene name
Bcl2l1
Definition
(RefSeq) bcl-2-like protein 1 isoform 2
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01524  Platinum drug resistance
rno04014  Ras signaling pathway
rno04064  NF-kappa B signaling pathway
rno04115  p53 signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04621  NOD-like receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05145  Toxoplasmosis
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05212  Pancreatic cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24888 (Bcl2l1)
   04630 JAK-STAT signaling pathway
    24888 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    24888 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    24888 (Bcl2l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24888 (Bcl2l1)
   04137 Mitophagy - animal
    24888 (Bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    24888 (Bcl2l1)
   04215 Apoptosis - multiple species
    24888 (Bcl2l1)
   04115 p53 signaling pathway
    24888 (Bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    24888 (Bcl2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24888 (Bcl2l1)
   05202 Transcriptional misregulation in cancer
    24888 (Bcl2l1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    24888 (Bcl2l1)
   05225 Hepatocellular carcinoma
    24888 (Bcl2l1)
   05220 Chronic myeloid leukemia
    24888 (Bcl2l1)
   05222 Small cell lung cancer
    24888 (Bcl2l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24888 (Bcl2l1)
   05170 Human immunodeficiency virus 1 infection
    24888 (Bcl2l1)
   05162 Measles
    24888 (Bcl2l1)
   05168 Herpes simplex virus 1 infection
    24888 (Bcl2l1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24888 (Bcl2l1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24888 (Bcl2l1)
   05014 Amyotrophic lateral sclerosis
    24888 (Bcl2l1)
   05022 Pathways of neurodegeneration - multiple diseases
    24888 (Bcl2l1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24888 (Bcl2l1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24888 (Bcl2l1)
   01524 Platinum drug resistance
    24888 (Bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24888 (Bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    24888 (Bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24888 (Bcl2l1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24888 (Bcl2l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    24888 (Bcl2l1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24888 (Bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 24888
NCBI-ProteinID: NP_001028842
RGD: 2200
Ensembl: ENSRNOG00000007946
UniProt: P53563
Structure
PDB: 
4QNQ 1AF3

Position
3
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctctcccagaaa
ggatacagctggagtcagtttagcgatgtcgaagagaacaggactgaagccccagaagaa
actgaaccagaaagggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gatagccccgcggtgaatggagccactggccacagcagcagtttggatgcgcgggaggta
atccccatggcagcagtgaagcaagcgctgagagaggctggcgatgagtttgaactgcgg
taccggagagcattcagtgatctaacatcccagcttcatataaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactctttcgggatggggtaaactggggtcgcatt
gtggccttcttctcctttggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggattgcaagttggatggccacctacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggatctctacgggaacaatgcagca
gccgagagccggaaaggccaggagcgtttcaaccgctggttcctgacgggcatgactgtg
gctggtgtagttctgctgggctcactcttcagtcggaagtga

DBGET integrated database retrieval system