KEGG   Rattus norvegicus (rat): 24889Help
Entry
24889             CDS       T01003                                 

Gene name
Cckar, Cck-ar
Definition
(RefSeq) cholecystokinin A receptor
  KO
K04194  cholecystokinin A receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04911  Insulin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24889 (Cckar)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24889 (Cckar)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24889 (Cckar)
  09154 Digestive system
   04972 Pancreatic secretion
    24889 (Cckar)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24889 (Cckar)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    24889 (Cckar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 CholecysA-Rec_N 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx NapE
Motif
Other DBs
NCBI-GeneID: 24889
NCBI-ProteinID: NP_036820
RGD: 2289
Ensembl: ENSRNOG00000043124
UniProt: P30551
Position
14q11
AA seq 444 aa AA seqDB search
MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQI
LLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK
DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAAT
WCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVM
VVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQL
SSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAE
KHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEE
DGRTIRALLSRYSYSHMSTSAPPP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagccattcaccagctcgccagcacttggtagaaagcagcaggatggacgtggtcgac
agccttcttatgaatgggagcaacatcactcccccctgtgaactcggactggaaaatgag
acgcttttctgcttggatcaacctcaaccttcaaaagagtggcagtctgcactgcagatt
ctcctgtactccatcatattccttctcagtgtgctggggaacacgctggttataacggtg
ctgattcgaaacaagaggatgcggacggtcaccaacatcttcctgctgtccctggctgtc
agtgacctcatgctctgcctcttctgcatgccgttcaacctcatccccaacctgctcaag
gatttcatcttcggaagtgccgtgtgcaagactaccacctacttcatgggcacttccgtg
agcgtttccaccttcaacctggtagccatctctctggagagatatggcgccatctgcaga
cccctacagtcccgcgtctggcaaacaaagtcccatgctttgaaggtcatcgctgccacc
tggtgcctctcctttaccatcatgactccgtaccccatttacagcaacttggtgcctttt
actaaaaataataaccagacggcgaacatgtgccgcttcctgttgccaagtgacgctatg
cagcagtcctggcaaacattcctgctactcatcctctttcttctccctgggattgtgatg
gtggtggcctacgggttgatctctctggaactctaccaaggaatcaaatttgatgccagc
cagaagaaatctgccaaagagaagaagccgagcactggcagcagcacccgatatgaggat
agtgatggctgttacttgcagaagtcccggcccccgaggaagctggagcttcagcagctg
tctagcggcagcggtggcagcagactcaaccggatcaggagcagcagttcagctgccaac
ctgatagccaagaagcgcgtgatccgcatgctcattgtcatcgtggtcctcttcttcctg
tgctggatgcccatcttcagcgccaacgcctggcgggcatatgacacggtttctgccgag
aagcacctctcagggactcccatctccttcatcctcctcctctcctacacctcctcctgt
gttaaccccatcatctattgcttcatgaacaaacgctttcgcctgggcttcatggccacc
ttcccttgttgcccgaatcccggtcccccaggggtgagaggagaggtgggagaggaggag
gatgggaggaccataagggcattgctgtccaggtattcctacagccacatgagcacctct
gctccacccccctga

DBGET integrated database retrieval system