KEGG   Rattus norvegicus (rat): 24890Help
Entry
24890             CDS       T01003                                 

Gene name
Esr1, ER-alpha, Esr, RNESTROR
Definition
(RefSeq) estrogen receptor 1
  KO
K08550  estrogen receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24890 (Esr1)
   04917 Prolactin signaling pathway
    24890 (Esr1)
   04919 Thyroid hormone signaling pathway
    24890 (Esr1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    24890 (Esr1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    24890 (Esr1)
   05205 Proteoglycans in cancer
    24890 (Esr1)
  09162 Cancers: Specific types
   05224 Breast cancer
    24890 (Esr1)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    24890 (Esr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24890 (Esr1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    24890 (Esr1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    24890 (Esr1)
Nuclear receptors [BR:rno03310]
 3. Estrogen like
  3A. Estrogen receptor
   24890 (Esr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Motif
Other DBs
NCBI-GeneID: 24890
NCBI-ProteinID: NP_036821
RGD: 2581
Ensembl: ENSRNOG00000019358
Vega: OTTRNOG00000001366
UniProt: P06211
Position
1q11
AA seq 600 aa AA seqDB search
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPAVFNYPEGAAY
EFNAAAAAAAAGASAPVYGQSSITYGPGSEAAAFGANSLGAFPQLNSVSPSPLMLLHPPP
HVSPFLHPHGHQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSSEKGNMI
MESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRK
SCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSP
LVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELV
HMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQG
KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHI
HRVLDKINDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVP
LYDLLLEMLDAHRLHAPASRMGVPPEEPSQSQLTTTSSTSAHSLQTYYIPPEAEGFPNTI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacccttcacaccaaagcctcgggaatggccttgttgcaccagatccaaggg
aacgagctggagcccctcaatcgcccgcagctcaagatgcccatggagagggctctgggc
gaggtgtacgtggacaacagcaagcccgccgtgttcaactaccccgagggcgccgcctac
gagttcaacgccgccgccgccgccgcggccgccggggcctcggctccggtctatggccag
tcgagcatcacttacggtccggggtccgaggcggccgcctttggtgccaatagtctgggg
gctttcccccagctcaacagcgtgtcgcccagtccgctgatgctgctgcacccgccgccg
cacgtgtcgccgttcctgcacccgcatggccaccaggtgccctactacctggagaacgag
cccagcgcctacgctgtacgcgacaccggccctcccgccttctacaggtccaattctgac
aatcgacgccagaatggccgagagagactctccagcagcagcgagaagggaaacatgatc
atggagtctgccaaggagactcgctactgtgctgtgtgtaacgactatgcctctggctac
cattatggggtctggtcctgtgaaggctgcaaggctttctttaagagaagcattcaagga
cataatgactacatgtgtccagctacaaaccaatgcaccatcgataagaaccggaggaag
agttgccaggcctgccggctgcgcaagtgttacgaagtgggcatgatgaaaggcgggata
cgaaaagaccgccgaggagggagaatgttgaagcacaagcgtcagagagatgacttggaa
ggccgaaatgaaatgggcacttcaggagacatgagagctgccaacctttggccaagtcca
cttgtgatcaagcacactaagaagaatagccccgccctgtccttgacagctgaccagatg
gtcagtgccttattggatgctgaaccacctttgatctattctgaatatgatccttctaga
cccttcagtgaagcctcaatgatgggcttattgaccaacctggcagacagggagctggtt
catatgatcaactgggcaaagagagtgccaggctttggggacttgaatctccacgatcaa
gttcaccttctggagtgtgcctggttggagatcctgatgattggtctggtctggcgctcc
atggaacacccggggaagctcctgtttgctcctaacttgctcttggacaggaatcaaggt
aaatgtgtagaaggcatggtggagatctttgacatgttgctggctacgtcaagtcgattc
cgcatgatgaacctgcagggagaagagtttgtgtgcctcaaatcaatcattttgcttaat
tctggagtgtacacatttctatccagcaccttgaagtctctggaagagaaggaccacatc
caccgagtcctggacaagatcaacgacactttgatccacttgatggccaaagctggcctg
actctgcagcaacagcatcgccgtctggcccagctcctcctcatcctttcccatatccgg
cacatgagtaacaaaggcatggagcatctctacaacatgaaatgcaagaatgtcgtgcct
ctctatgacctgctgctggagatgctggatgctcatcgtcttcatgcccccgccagtcgc
atgggagtgcccccggaggagcctagccagagccagctgaccaccaccagctccacttca
gcacattccttacaaacctactacatccccccggaagcagagggcttccccaacaccatc
tga

DBGET integrated database retrieval system