KEGG   Rattus norvegicus (rat): 24896
Entry
24896             CDS       T01003                                 

Gene name
Gnas
Definition
(RefSeq) SCG6 (secretogranin VI) isoform SCG6 precursor
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
rno05142  Chagas disease
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    24896 (Gnas)
   04020 Calcium signaling pathway
    24896 (Gnas)
   04072 Phospholipase D signaling pathway
    24896 (Gnas)
   04024 cAMP signaling pathway
    24896 (Gnas)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24896 (Gnas)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24896 (Gnas)
  09152 Endocrine system
   04911 Insulin secretion
    24896 (Gnas)
   04922 Glucagon signaling pathway
    24896 (Gnas)
   04923 Regulation of lipolysis in adipocytes
    24896 (Gnas)
   04912 GnRH signaling pathway
    24896 (Gnas)
   04913 Ovarian steroidogenesis
    24896 (Gnas)
   04915 Estrogen signaling pathway
    24896 (Gnas)
   04921 Oxytocin signaling pathway
    24896 (Gnas)
   04926 Relaxin signaling pathway
    24896 (Gnas)
   04935 Growth hormone synthesis, secretion and action
    24896 (Gnas)
   04918 Thyroid hormone synthesis
    24896 (Gnas)
   04928 Parathyroid hormone synthesis, secretion and action
    24896 (Gnas)
   04916 Melanogenesis
    24896 (Gnas)
   04924 Renin secretion
    24896 (Gnas)
   04925 Aldosterone synthesis and secretion
    24896 (Gnas)
   04927 Cortisol synthesis and secretion
    24896 (Gnas)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24896 (Gnas)
   04270 Vascular smooth muscle contraction
    24896 (Gnas)
  09154 Digestive system
   04970 Salivary secretion
    24896 (Gnas)
   04971 Gastric acid secretion
    24896 (Gnas)
   04972 Pancreatic secretion
    24896 (Gnas)
   04976 Bile secretion
    24896 (Gnas)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    24896 (Gnas)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24896 (Gnas)
  09156 Nervous system
   04724 Glutamatergic synapse
    24896 (Gnas)
   04728 Dopaminergic synapse
    24896 (Gnas)
   04726 Serotonergic synapse
    24896 (Gnas)
   04730 Long-term depression
    24896 (Gnas)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24896 (Gnas)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24896 (Gnas)
   04714 Thermogenesis
    24896 (Gnas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24896 (Gnas)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    24896 (Gnas)
   05165 Human papillomavirus infection
    24896 (Gnas)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24896 (Gnas)
   05142 Chagas disease
    24896 (Gnas)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24896 (Gnas)
  09165 Substance dependence
   05030 Cocaine addiction
    24896 (Gnas)
   05031 Amphetamine addiction
    24896 (Gnas)
   05032 Morphine addiction
    24896 (Gnas)
   05034 Alcoholism
    24896 (Gnas)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    24896 (Gnas)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24896 (Gnas)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    24896 (Gnas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24896 (Gnas)
   04031 GTP-binding proteins [BR:rno04031]
    24896 (Gnas)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24896 (Gnas)
  Exosomal proteins of other body fluids (saliva and urine)
   24896 (Gnas)
  Exosomal proteins of colorectal cancer cells
   24896 (Gnas)
  Exosomal proteins of bladder cancer cells
   24896 (Gnas)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    24896 (Gnas)
SSDB
Motif
Pfam: NESP55 Trypan_PARP MARVEL
Other DBs
NCBI-GeneID: 24896
NCBI-ProteinID: NP_001153125
RGD: 2716
Ensembl: ENSRNOG00000025889
UniProt: Q792G6 G3V916 B4F771
Position
3
AA seq 256 aa
MDRRSRAHQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRR
SFLNAHHRSAAAAAAAQVLPESSESESDHEHEEAEPELARPECLEYDQDDYETETDSETE
PESDIQSETEFETEPETEPETAPTTEPETEPEDERGPRGATFNQSLTQRLHALKLQSADA
SPRRAQPTTQEPESASEGEEPQREPLDEDPRDPEESEELREANRQPRRCKTRRPARRRDQ
SPESPPRKGPIPIRRH
NT seq 771 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgggctcatcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgggctgctaccgctctcctctggctctcctgctccatcgct
ctcctccgcgccctagcctcttccaacgcccgcgcccagcagcgggctgcccagcgccgg
agcttccttaacgcccaccaccgctccgctgccgctgcagctgccgcacaggtactcccc
gagtcctctgaatccgaatctgatcacgagcacgaggaggctgagcctgagctggcccgc
cccgagtgcctagagtacgatcaggacgactacgagaccgagaccgattctgagaccgag
cctgagtccgatatccagtccgagaccgaattcgagaccgagcctgagaccgagcctgag
accgcccctacaactgagcctgagaccgaaccagaggacgagcgcggcccccggggcgcc
accttcaaccagtcactcactcagcgtctgcacgctctgaagttgcagagcgccgacgcc
tccccgagacgtgcgcagcccaccactcaggagcctgagagcgcaagcgagggggaggag
ccccagcgcgagcccttagacgaggatcctcgggaccccgaggagtcagaggagctcagg
gaggcgaacaggcagccccgccgctgcaagaccaggaggccagcccgccgtcgcgaccag
tccccggagtcccctcccagaaaggggcccatccccatccggcgtcactaa

DBGET integrated database retrieval system