KEGG   Rattus norvegicus (rat): 24896
Entry
24896             CDS       T01003                                 

Gene name
Gnas
Definition
(RefSeq) SCG6 (secretogranin VI) isoform SCG6 precursor
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
rno05142  Chagas disease
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    24896 (Gnas)
   04020 Calcium signaling pathway
    24896 (Gnas)
   04072 Phospholipase D signaling pathway
    24896 (Gnas)
   04024 cAMP signaling pathway
    24896 (Gnas)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24896 (Gnas)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24896 (Gnas)
  09152 Endocrine system
   04911 Insulin secretion
    24896 (Gnas)
   04922 Glucagon signaling pathway
    24896 (Gnas)
   04923 Regulation of lipolysis in adipocytes
    24896 (Gnas)
   04912 GnRH signaling pathway
    24896 (Gnas)
   04913 Ovarian steroidogenesis
    24896 (Gnas)
   04915 Estrogen signaling pathway
    24896 (Gnas)
   04921 Oxytocin signaling pathway
    24896 (Gnas)
   04926 Relaxin signaling pathway
    24896 (Gnas)
   04935 Growth hormone synthesis, secretion and action
    24896 (Gnas)
   04918 Thyroid hormone synthesis
    24896 (Gnas)
   04928 Parathyroid hormone synthesis, secretion and action
    24896 (Gnas)
   04916 Melanogenesis
    24896 (Gnas)
   04924 Renin secretion
    24896 (Gnas)
   04925 Aldosterone synthesis and secretion
    24896 (Gnas)
   04927 Cortisol synthesis and secretion
    24896 (Gnas)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24896 (Gnas)
   04270 Vascular smooth muscle contraction
    24896 (Gnas)
  09154 Digestive system
   04970 Salivary secretion
    24896 (Gnas)
   04971 Gastric acid secretion
    24896 (Gnas)
   04972 Pancreatic secretion
    24896 (Gnas)
   04976 Bile secretion
    24896 (Gnas)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    24896 (Gnas)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24896 (Gnas)
  09156 Nervous system
   04724 Glutamatergic synapse
    24896 (Gnas)
   04728 Dopaminergic synapse
    24896 (Gnas)
   04726 Serotonergic synapse
    24896 (Gnas)
   04730 Long-term depression
    24896 (Gnas)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24896 (Gnas)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24896 (Gnas)
   04714 Thermogenesis
    24896 (Gnas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24896 (Gnas)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    24896 (Gnas)
   05165 Human papillomavirus infection
    24896 (Gnas)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24896 (Gnas)
   05142 Chagas disease
    24896 (Gnas)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24896 (Gnas)
  09165 Substance dependence
   05030 Cocaine addiction
    24896 (Gnas)
   05031 Amphetamine addiction
    24896 (Gnas)
   05032 Morphine addiction
    24896 (Gnas)
   05034 Alcoholism
    24896 (Gnas)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    24896 (Gnas)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24896 (Gnas)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    24896 (Gnas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24896 (Gnas)
   04031 GTP-binding proteins [BR:rno04031]
    24896 (Gnas)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24896 (Gnas)
  Exosomal proteins of other body fluids (saliva and urine)
   24896 (Gnas)
  Exosomal proteins of colorectal cancer cells
   24896 (Gnas)
  Exosomal proteins of bladder cancer cells
   24896 (Gnas)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    24896 (Gnas)
SSDB
Motif
Pfam: NESP55 Trypan_PARP MARVEL
Other DBs
NCBI-GeneID: 24896
NCBI-ProteinID: NP_001153125
RGD: 2716
Ensembl: ENSRNOG00000025889
UniProt: Q792G6 G3V916 B4F771
Position
3
AA seq 256 aa
MDRRSRAHQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRR
SFLNAHHRSAAAAAAAQVLPESSESESDHEHEEAEPELARPECLEYDQDDYETETDSETE
PESDIQSETEFETEPETEPETAPTTEPETEPEDERGPRGATFNQSLTQRLHALKLQSADA
SPRRAQPTTQEPESASEGEEPQREPLDEDPRDPEESEELREANRQPRRCKTRRPARRRDQ
SPESPPRKGPIPIRRH
NT seq 771 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgggctcatcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgggctgctaccgctctcctctggctctcctgctccatcgct
ctcctccgcgccctagcctcttccaacgcccgcgcccagcagcgggctgcccagcgccgg
agcttccttaacgcccaccaccgctccgctgccgctgcagctgccgcacaggtactcccc
gagtcctctgaatccgaatctgatcacgagcacgaggaggctgagcctgagctggcccgc
cccgagtgcctagagtacgatcaggacgactacgagaccgagaccgattctgagaccgag
cctgagtccgatatccagtccgagaccgaattcgagaccgagcctgagaccgagcctgag
accgcccctacaactgagcctgagaccgaaccagaggacgagcgcggcccccggggcgcc
accttcaaccagtcactcactcagcgtctgcacgctctgaagttgcagagcgccgacgcc
tccccgagacgtgcgcagcccaccactcaggagcctgagagcgcaagcgagggggaggag
ccccagcgcgagcccttagacgaggatcctcgggaccccgaggagtcagaggagctcagg
gaggcgaacaggcagccccgccgctgcaagaccaggaggccagcccgccgtcgcgaccag
tccccggagtcccctcccagaaaggggcccatccccatccggcgtcactaa

KEGG   Rattus norvegicus (rat): 25643
Entry
25643             CDS       T01003                                 

Gene name
Gnai3
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04360  Axon guidance
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
rno05133  Pertussis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25643 (Gnai3)
   04371 Apelin signaling pathway
    25643 (Gnai3)
   04071 Sphingolipid signaling pathway
    25643 (Gnai3)
   04024 cAMP signaling pathway
    25643 (Gnai3)
   04022 cGMP-PKG signaling pathway
    25643 (Gnai3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25643 (Gnai3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25643 (Gnai3)
   04670 Leukocyte transendothelial migration
    25643 (Gnai3)
   04062 Chemokine signaling pathway
    25643 (Gnai3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25643 (Gnai3)
   04915 Estrogen signaling pathway
    25643 (Gnai3)
   04914 Progesterone-mediated oocyte maturation
    25643 (Gnai3)
   04921 Oxytocin signaling pathway
    25643 (Gnai3)
   04926 Relaxin signaling pathway
    25643 (Gnai3)
   04935 Growth hormone synthesis, secretion and action
    25643 (Gnai3)
   04928 Parathyroid hormone synthesis, secretion and action
    25643 (Gnai3)
   04916 Melanogenesis
    25643 (Gnai3)
   04924 Renin secretion
    25643 (Gnai3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25643 (Gnai3)
  09154 Digestive system
   04971 Gastric acid secretion
    25643 (Gnai3)
  09156 Nervous system
   04724 Glutamatergic synapse
    25643 (Gnai3)
   04727 GABAergic synapse
    25643 (Gnai3)
   04725 Cholinergic synapse
    25643 (Gnai3)
   04728 Dopaminergic synapse
    25643 (Gnai3)
   04726 Serotonergic synapse
    25643 (Gnai3)
   04730 Long-term depression
    25643 (Gnai3)
   04723 Retrograde endocannabinoid signaling
    25643 (Gnai3)
  09158 Development and regeneration
   04360 Axon guidance
    25643 (Gnai3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25643 (Gnai3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25643 (Gnai3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25643 (Gnai3)
   05163 Human cytomegalovirus infection
    25643 (Gnai3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    25643 (Gnai3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25643 (Gnai3)
   05142 Chagas disease
    25643 (Gnai3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25643 (Gnai3)
  09165 Substance dependence
   05030 Cocaine addiction
    25643 (Gnai3)
   05032 Morphine addiction
    25643 (Gnai3)
   05034 Alcoholism
    25643 (Gnai3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25643 (Gnai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25643 (Gnai3)
   04031 GTP-binding proteins [BR:rno04031]
    25643 (Gnai3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25643 (Gnai3)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    25643 (Gnai3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 25643
NCBI-ProteinID: NP_037238
RGD: 2714
Ensembl: ENSRNOG00000019465
UniProt: P08753
Structure
PDB: 
6MHF 6MHE

Position
2
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacttgcgggaggacggagagaaagcggccaaagaagtgaagctgctgctgctcggc
gctggagaatctggtaaaagtactattgtgaaacagatgaaaatcattcatgaggatggc
tattccgaggacgagtgtaagcagtataaagttgtcgtctacagcaataccattcagtcc
atcattgcaatcataagagccatgggacggttgaagattgattttggggaagctgccaga
gcggatgatgcccgacagttatttgttttagctggcagtgctgaggaaggagtcatgact
tcagaactagcaggcgtgattaaacgtttatggcgagatggcggggtgcaggcatgcttc
agcaggtccagggaatatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccagaccaactacattccaactcagcaagatgttcttcggacgagagtgaag
actacaggcattgtggagacccacttcaccttcaaggagctctacttcaaaatgtttgat
gtaggtggccaaagatccgaacggaaaaagtggatccactgttttgagggagtgacagca
attatcttttgtgtggctctcagtgattacgaccttgttctggctgaggacgaggaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctcttccttaataagaaagacctttttgaggaaaaaataaagagg
agtccattaacaatctgttatccagaatacacaggttccaatacgtacgaagaggcagct
gcttacatccagtgccagtttgaagatctgaaccgaagaaaggacaccaaggaggtctac
actcactttacctgtgccactgacaccaaaaacgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtgggctttactga

KEGG   Rattus norvegicus (rat): 25686
Entry
25686             CDS       T01003                                 

Gene name
Gnai1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04360  Axon guidance
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
rno05133  Pertussis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25686 (Gnai1)
   04371 Apelin signaling pathway
    25686 (Gnai1)
   04071 Sphingolipid signaling pathway
    25686 (Gnai1)
   04024 cAMP signaling pathway
    25686 (Gnai1)
   04022 cGMP-PKG signaling pathway
    25686 (Gnai1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25686 (Gnai1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25686 (Gnai1)
   04670 Leukocyte transendothelial migration
    25686 (Gnai1)
   04062 Chemokine signaling pathway
    25686 (Gnai1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25686 (Gnai1)
   04915 Estrogen signaling pathway
    25686 (Gnai1)
   04914 Progesterone-mediated oocyte maturation
    25686 (Gnai1)
   04921 Oxytocin signaling pathway
    25686 (Gnai1)
   04926 Relaxin signaling pathway
    25686 (Gnai1)
   04935 Growth hormone synthesis, secretion and action
    25686 (Gnai1)
   04928 Parathyroid hormone synthesis, secretion and action
    25686 (Gnai1)
   04916 Melanogenesis
    25686 (Gnai1)
   04924 Renin secretion
    25686 (Gnai1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25686 (Gnai1)
  09154 Digestive system
   04971 Gastric acid secretion
    25686 (Gnai1)
  09156 Nervous system
   04724 Glutamatergic synapse
    25686 (Gnai1)
   04727 GABAergic synapse
    25686 (Gnai1)
   04725 Cholinergic synapse
    25686 (Gnai1)
   04728 Dopaminergic synapse
    25686 (Gnai1)
   04726 Serotonergic synapse
    25686 (Gnai1)
   04730 Long-term depression
    25686 (Gnai1)
   04723 Retrograde endocannabinoid signaling
    25686 (Gnai1)
  09158 Development and regeneration
   04360 Axon guidance
    25686 (Gnai1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25686 (Gnai1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25686 (Gnai1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25686 (Gnai1)
   05163 Human cytomegalovirus infection
    25686 (Gnai1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    25686 (Gnai1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25686 (Gnai1)
   05142 Chagas disease
    25686 (Gnai1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25686 (Gnai1)
  09165 Substance dependence
   05030 Cocaine addiction
    25686 (Gnai1)
   05032 Morphine addiction
    25686 (Gnai1)
   05034 Alcoholism
    25686 (Gnai1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25686 (Gnai1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25686 (Gnai1)
   04031 GTP-binding proteins [BR:rno04031]
    25686 (Gnai1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25686 (Gnai1)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    25686 (Gnai1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 25686
NCBI-ProteinID: NP_037277
RGD: 2713
Ensembl: ENSRNOG00000057096
UniProt: P10824
Structure
PDB: 

Position
4
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacactgagcgctgaggacaaggcggccgtggagcgcagcaagatgatcgac
cgcaacctccgggaggacggagagaaggcagcgcgcgaggtcaagctgctgctgctgggt
gctggtgaatccgggaagagcacaattgtgaagcagatgaaaattatccacgaggctggc
tactcagaggaagagtgtaagcagtacaaagcagtggtctacagcaacaccatccagtcc
atcattgccatcattagagccatggggagattgaaaatcgactttggagacgctgctcgt
gcggatgatgctcgccaactcttcgtgcttgctggggctgcagaggaaggctttatgacc
gcggagctcgccggcgtcataaagagactgtggaaggacagcggtgtgcaagcctgcttc
aacagatcccgggagtaccagctgaacgattcggcggcgtactacctgaatgacttggac
agaatagcacaaccaaattacatcccaacccagcaggatgttctcagaactagagtgaaa
acgacgggaattgtggaaacccactttactttcaaagatcttcattttaaaatgtttgac
gtgggaggccagagatcagagcggaagaagtggattcactgctttgaaggcgtgactgcc
atcatcttctgtgtggccctgagtgactatgacctggttcttgctgaggatgaagaaatg
aaccggatgcatgaaagcatgaagctgttcgatagcatatgtaacaacaagtggtttacg
gacacatccatcatccttttcctgaacaagaaggacctcttcgaagagaagatcaaaaag
agtcccctcacgatatgctatccagaatatgcaggctcaaacacatatgaagaggcggct
gcgtatatccagtgtcagtttgaagacctcaataaaaggaaggacacaaaggaaatttac
acccacttcacttgcgccacggatacgaagaatgtgcagtttgtgttcgatgctgtaacg
gacgtcatcataaagaataacctaaaagactgtggtctcttctaa

KEGG   Rattus norvegicus (rat): 25740
Entry
25740             CDS       T01003                                 

Gene name
Gnaz
Definition
(RefSeq) guanine nucleotide-binding protein G(z) subunit alpha
  KO
K04535  guanine nucleotide-binding protein G(z) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    25740 (Gnaz)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    25740 (Gnaz)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    25740 (Gnaz)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29 TniB AAA_16
Other DBs
NCBI-GeneID: 25740
NCBI-ProteinID: NP_037321
RGD: 2717
Ensembl: ENSRNOG00000001313
UniProt: P19627
Position
20
AA seq 355 aa
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLEACKEYKPLIIYNAIDSLTRIIRALAALKIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMRRLWADPGAQACFGRSSEYHLEDNAAYYLNDLERIAAPDYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLSEKIRRIPLSVCFPEYKGQNTYEEA
AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggatgtcggcaaagctcagaggaaaaagaggcagcgcggcggtcgaggagaattgac
cgccacctgcgctcggagagccagcggcagcgccgtgagatcaaacttctcctgctgggc
accagcaactcgggcaagagcaccatcgtcaagcagatgaaaatcatccacagcggtggt
ttcaacctggaggcctgcaaggagtacaagcccctcatcatctacaacgccatcgactcg
ctgacccgcatcattcgggccctggctgccctgaagattgatttccacaaccctgaccgt
gcctacgacgccgtgcagctctttgccctgactggcccggcagagagcaagggtgagatc
acgcccgagctgctgggtgtcatgcgacggctctgggctgaccccggggcccaggcctgc
ttcggccgctccagcgagtaccacctggaggacaacgccgcttactacctgaatgacctg
gagcgcatcgcggcgcccgactatatccccacggtggaggacatcctgcgctctcgggac
atgaccacgggcattgtggaaaacaagttcaccttcaaggagcttaccttcaagatggtg
gatgtgggagggcagaggtcagagcgcaaaaaatggatccactgctttgagggcgtgacg
gccatcatcttctgtgtggagctcagtggctatgacctgaagctttatgaggacaaccag
acgagccgaatggcggagagcctgcgtctttttgactccatctgcaacaacaactggttc
atcaacacctccctcatcctcttcctgaacaagaaggacctcctgtcggagaagattcgg
cgtatcccgctcagcgtctgcttccccgagtacaagggtcagaacacgtacgaggaagcc
gcggtctacatccagcgtcagttcgaggacctaaaccgaaacaaggagaccaaggagatc
tactcgcactttacctgtgccaccgacaccagtaacatccagtttgtcttcgacgcagtg
acagatgtcatcatacagaacaatctcaagtacattggcctttgctga

KEGG   Rattus norvegicus (rat): 303634
Entry
303634            CDS       T01003                                 

Gene name
Gna13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04611  Platelet activation
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    303634 (Gna13)
   04072 Phospholipase D signaling pathway
    303634 (Gna13)
   04071 Sphingolipid signaling pathway
    303634 (Gna13)
   04022 cGMP-PKG signaling pathway
    303634 (Gna13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    303634 (Gna13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    303634 (Gna13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    303634 (Gna13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    303634 (Gna13)
  09156 Nervous system
   04730 Long-term depression
    303634 (Gna13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303634 (Gna13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    303634 (Gna13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    303634 (Gna13)
   04031 GTP-binding proteins [BR:rno04031]
    303634 (Gna13)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   303634 (Gna13)
  Exosomal proteins of colorectal cancer cells
   303634 (Gna13)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    303634 (Gna13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 303634
NCBI-ProteinID: NP_001013137
RGD: 1310221
Ensembl: ENSRNOG00000036745
UniProt: Q6Q7Y5
Position
10
AA seq 377 aa
MADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKNQVHGD
KLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWDDSGIQNAYDRRREFQLGESVKYFLDN
LDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDQQQRPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcgctccgtgctgtccgtgtgcttcccgggctgcgtgctg
acgaacggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtcgcgg
gagaagacctacgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacggccaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggta
gatgcccgagagaagcttcatattccctggggagataacaaaaaccaggtccacggagac
aagttgatggcatttgatacccgagctcccatggctgcccaggggatggtggagactcga
gtttttttgcagtatcttcctgctataagagccttatgggatgacagtggcatacagaat
gcctacgatcggcgccgggaattccaactgggtgagtctgtaaagtatttcctggataac
ttggataaacttggagtaccggactacattccgtcacagcaagatattctgcttgccaga
agacccaccaaaggcatccatgagtatgactttgaaattaaaaatgttcctttcaaaatg
gttgacgtaggtggccagagatcagaacggaaacgttggtttgaatgctttgacagtgtg
acatcaatactcttccttgtttcttcaagtgagtttgaccaggtgcttatggaggaccgc
ctgaccaaccgcctcacagagtccctgaacatttttgaaacaattgtcaataaccgggtt
ttcagcaatgtctctataattctcttcttaaacaagacagacttgcttgaggagaaagtg
caagttgtaagcatcaaagactatttcctagaatttgaaggggaccctcactgcttaaga
gacgtccaaaagtttctggtggaatgcttccgggggaaacgccgggaccagcagcagagg
ccgctgtaccaccacttcaccaccgccatcaacacagagaacatccgccttgtgttccga
gacgtgaaggacacgatccttcatgacaacctcaagcagcttatgctccagtga

KEGG   Rattus norvegicus (rat): 50664
Entry
50664             CDS       T01003                                 

Gene name
Gnao1
Definition
(RefSeq) guanine nucleotide-binding protein G(o) subunit alpha
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno05032  Morphine addiction
rno05034  Alcoholism
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    50664 (Gnao1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    50664 (Gnao1)
   04921 Oxytocin signaling pathway
    50664 (Gnao1)
   04926 Relaxin signaling pathway
    50664 (Gnao1)
   04916 Melanogenesis
    50664 (Gnao1)
  09156 Nervous system
   04724 Glutamatergic synapse
    50664 (Gnao1)
   04727 GABAergic synapse
    50664 (Gnao1)
   04725 Cholinergic synapse
    50664 (Gnao1)
   04728 Dopaminergic synapse
    50664 (Gnao1)
   04726 Serotonergic synapse
    50664 (Gnao1)
   04730 Long-term depression
    50664 (Gnao1)
   04723 Retrograde endocannabinoid signaling
    50664 (Gnao1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    50664 (Gnao1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    50664 (Gnao1)
   05163 Human cytomegalovirus infection
    50664 (Gnao1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    50664 (Gnao1)
   05142 Chagas disease
    50664 (Gnao1)
  09165 Substance dependence
   05032 Morphine addiction
    50664 (Gnao1)
   05034 Alcoholism
    50664 (Gnao1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    50664 (Gnao1)
   04031 GTP-binding proteins [BR:rno04031]
    50664 (Gnao1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   50664 (Gnao1)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    50664 (Gnao1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA DUF685 TniB AAA_29
Other DBs
NCBI-GeneID: 50664
NCBI-ProteinID: NP_059023
RGD: 628732
Ensembl: ENSRNOG00000019482
UniProt: P59215
Position
19
AA seq 354 aa
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKADSKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDA
AAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaatctcaaagaagatggcatcagcgccgccaaagacgtgaaattactcctgctgggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccatgaagatggc
ttctctggagaagacgtaaagcagtacaagcctgtcgtctacagcaacaccatccagtct
ctggcagccattgtgcgggccatggatactctgggcgtggagtatggtgacaaggagagg
aaggcagactccaagatggtgtgtgacgtggtgagtcgcatggaggacactgaaccattc
tctgcagaactgctttctgccatgatgcgactctggggcgactcggggatccaggagtgc
ttcaaccgatctcgggagtatcagctcaacgactctgccaaatactacctggacagcttg
gatcggattggagccgctgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaacaactggcatcgtagaaacccacttcaccttcaagaacctccacttcaggctgttt
gacgttgggggccagcgatctgaacgtaagaagtggatccactgcttcgaggatgtcacg
gccatcatcttctgtgtcgcactcagcggctatgaccaggtgctccacgaggacgaaacc
acgaaccgcatgcacgagtctctcatgctcttcgactccatctgtaacaacaagtttttc
atcgatacctccatcattctcttcctcaacaagaaagacctctttggcgagaagattaag
aagtcacccttgaccatctgctttcctgaatacccaggctccaacacctatgaagacgca
gctgcctacatccaaacacagtttgaaagcaaaaaccgctcacccaacaaagaaatttac
tgtcacatgacttgtgccacagacacgaataatatccaggtggtattcgacgccgtcacc
gacatcatcattgccaacaatctccggggctgtggcttgtactga

KEGG   Rattus norvegicus (rat): 81663
Entry
81663             CDS       T01003                                 

Gene name
Gna12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04270  Vascular smooth muscle contraction
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81663 (Gna12)
   04072 Phospholipase D signaling pathway
    81663 (Gna12)
   04071 Sphingolipid signaling pathway
    81663 (Gna12)
   04022 cGMP-PKG signaling pathway
    81663 (Gna12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81663 (Gna12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    81663 (Gna12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81663 (Gna12)
  09156 Nervous system
   04730 Long-term depression
    81663 (Gna12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81663 (Gna12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    81663 (Gna12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81663 (Gna12)
   04031 GTP-binding proteins [BR:rno04031]
    81663 (Gna12)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   81663 (Gna12)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    81663 (Gna12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 81663
NCBI-ProteinID: NP_112296
RGD: 71018
Ensembl: ENSRNOG00000001235
Vega: OTTRNOG00000002220
UniProt: Q63210 Q45QM2
Position
12
AA seq 379 aa
MSGVVRTLSRCLLPAEAGARERRAGAARDAEREARRRSRDIDALLARERRAVRRLVKILL
LGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHS
ENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYF
LDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCF
DGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLV
EKVKSVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRGKPLFHHFTTAIDTENIRFV
FHAVKDTILQENLKDIMLQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcttgctgccggccgaggccggagcccgc
gagcgcagggcgggcgcggcgcgcgacgcggaacgcgaggcccgacggcgcagccgcgac
atcgacgcgctgctggcccgcgagcggcgcgcggtgcggcggctggtcaagatcttgctg
ctgggcgccggcgagagcggcaagtccaccttcctcaagcagatgcgcatcatccacggc
cgggagttcgaccagaaggcgctgctggagttccgcgacaccatcttcgacaacatcctt
aagggctcgagggtgcttgtagacgctcgggacaagcttggcattccctggcagcactct
gagaacgagaagcacgggatgtttctgatggccttcgagaacaaggcagggctgcctgtg
gagcctgccaccttccagctctacgttccagccctgagcgcactctggagagactccggg
atcagggaagccttcagccgcagaagcgagttccagctgggtgagtcagtgaagtacttc
ctggataacttagaccggattggccagctgaactacttccccagtaagcaagacatcctg
ttggctagaaaggccaccaagggaatcgtggagcatgacttcgtgataaagaaaatccca
tttaagatggtggatgtgggcggccagaggtcgcagcgccagaagtggttccagtgcttc
gacgggatcacatcgatcctgttcatggtgtcctcaagcgagtatgaccaggtcctcatg
gaggataggcgcaccaaccggctggtggagtccatgaacatcttcgagaccatcgtcaac
aacaagctcttcttcaacgtctccatcatcctcttcctcaacaagatggacctgctggtg
gagaaggtgaagtcggtgagcattaagaagcacttcccagacttcaagggcgacccgcac
cggctggaggacgtccagcgctacctggtccagtgctttgacaggaagcgcaggaaccgc
ggcaagcctctgttccaccacttcaccactgccatagacaccgagaacatccgcttcgtg
tttcatgccgtgaaggacaccatcctgcaggagaacctgaaagatatcatgctgcagtga

KEGG   Rattus norvegicus (rat): 81664
Entry
81664             CDS       T01003                                 

Gene name
Gnai2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04360  Axon guidance
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
rno05133  Pertussis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    81664 (Gnai2)
   04371 Apelin signaling pathway
    81664 (Gnai2)
   04071 Sphingolipid signaling pathway
    81664 (Gnai2)
   04024 cAMP signaling pathway
    81664 (Gnai2)
   04022 cGMP-PKG signaling pathway
    81664 (Gnai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    81664 (Gnai2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81664 (Gnai2)
   04670 Leukocyte transendothelial migration
    81664 (Gnai2)
   04062 Chemokine signaling pathway
    81664 (Gnai2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    81664 (Gnai2)
   04915 Estrogen signaling pathway
    81664 (Gnai2)
   04914 Progesterone-mediated oocyte maturation
    81664 (Gnai2)
   04921 Oxytocin signaling pathway
    81664 (Gnai2)
   04926 Relaxin signaling pathway
    81664 (Gnai2)
   04935 Growth hormone synthesis, secretion and action
    81664 (Gnai2)
   04928 Parathyroid hormone synthesis, secretion and action
    81664 (Gnai2)
   04916 Melanogenesis
    81664 (Gnai2)
   04924 Renin secretion
    81664 (Gnai2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81664 (Gnai2)
  09154 Digestive system
   04971 Gastric acid secretion
    81664 (Gnai2)
  09156 Nervous system
   04724 Glutamatergic synapse
    81664 (Gnai2)
   04727 GABAergic synapse
    81664 (Gnai2)
   04725 Cholinergic synapse
    81664 (Gnai2)
   04728 Dopaminergic synapse
    81664 (Gnai2)
   04726 Serotonergic synapse
    81664 (Gnai2)
   04730 Long-term depression
    81664 (Gnai2)
   04723 Retrograde endocannabinoid signaling
    81664 (Gnai2)
  09158 Development and regeneration
   04360 Axon guidance
    81664 (Gnai2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    81664 (Gnai2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81664 (Gnai2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    81664 (Gnai2)
   05163 Human cytomegalovirus infection
    81664 (Gnai2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    81664 (Gnai2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    81664 (Gnai2)
   05142 Chagas disease
    81664 (Gnai2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    81664 (Gnai2)
  09165 Substance dependence
   05030 Cocaine addiction
    81664 (Gnai2)
   05032 Morphine addiction
    81664 (Gnai2)
   05034 Alcoholism
    81664 (Gnai2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81664 (Gnai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81664 (Gnai2)
   04031 GTP-binding proteins [BR:rno04031]
    81664 (Gnai2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   81664 (Gnai2)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    81664 (Gnai2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Other DBs
NCBI-GeneID: 81664
NCBI-ProteinID: NP_112297
RGD: 620243
Ensembl: ENSRNOG00000016592
UniProt: P04897 Q45QN0
Position
8
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGML
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcagccgagcgctctaagatgatcgac
aagaacctgcgggaggacggcgagaaggcggcacgggaggtgaagttgcttctgttaggt
gctggagaatcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggc
tactcagaggaggagtgccggcagtaccgtgcggttgtctacagcaacaccatccagtct
atcatggccatcgtcaaagccatgggcaacctgcagatcgactttgctgacccccagcgt
gcggatgatgccaggcagctgttcgcactgtcctgtgctgccgaggagcaaggcatgctt
ccggaagacctgtcgggcgtcatccggaggctctgggctgaccatggtgtgcaagcctgc
tttggccgctcacgggaatatcaactcaatgactcagccgcttactacctgaatgacctg
gagcgcatagcacagagtgactatatccctacacagcaggatgtgctgcggacccgtgtg
aagaccacaggcatcgtcgaaacacacttcaccttcaaggacttacacttcaagatgttt
gatgtgggtggtcagcgatctgagcggaagaagtggatccactgctttgagggtgtcacg
gccatcatcttctgtgtcgccttgagcgcgtacgacttggtgctggctgaggatgaggag
atgaatcgcatgcatgagagcatgaagctgtttgatagcatctgcaataataagtggttc
acagacacctccatcatcctcttcctcaacaagaaggacctgtttgaagagaagatcaca
cagagccccctgaccatctgtttccctgagtacacaggggccaacaagtatgacgaggca
gccagctacatccagagcaagtttgaggacctgaataaacgcaaagacaccaaggagatc
tacacgcacttcacatgcgccaccgacaccaagaacgtgcagtttgtgtttgatgccgtc
actgacgtcatcatcaagaacaacctgaaggactgtggcctcttctga

DBGET integrated database retrieval system