KEGG   Rattus norvegicus (rat): 24898Help
Entry
24898             CDS       T01003                                 

Gene name
Slc6a3, Dat1
Definition
(RefSeq) solute carrier family 6 member 3
  KO
K05036  solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    24898 (Slc6a3)
   04721 Synaptic vesicle cycle
    24898 (Slc6a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24898 (Slc6a3)
  09165 Substance dependence
   05030 Cocaine addiction
    24898 (Slc6a3)
   05031 Amphetamine addiction
    24898 (Slc6a3)
   05034 Alcoholism
    24898 (Slc6a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24898 (Slc6a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   24898 (Slc6a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 24898
NCBI-ProteinID: NP_036826
RGD: 3715
Ensembl: ENSRNOG00000017302
UniProt: P23977
Position
1p11
AA seq 619 aa AA seqDB search
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagcaaatgctccgtgggaccaatgtcttcagtggtggccccggctaaagag
tccaatgctgtgggccccagagaggtggagctcatcctggtcaaggagcagaacggagtg
cagctgaccaactccaccctcatcaacccgccacagacaccagtggaggctcaagagcgg
gagacctggagcaagaaaattgatttcctgctatcagtcatcggctttgctgtggacctg
gccaatgtctggaggtttccctacctgtgctacaaaaatggtggaggtgccttcctggtg
ccctacctgctcttcatggttattgctgggatgcccctcttctacatggagctggctctc
ggacagttcaacagagaaggagctgctggtgtctggaagatctgtcctgtcctgaaaggt
gtgggcttcactgttatcctcatctctttctacgtgggcttcttctacaatgtcatcatc
gcatgggcactgcactacttcttctcctccttcaccatggacctcccatggatccactgc
aacaacacctggaatagccccaactgctccgatgcccatgccagcaactctagcgacggc
ctgggcctcaatgacacctttgggaccacacccgctgctgagtactttgagcgtggcgtg
ctgcaccttcaccagagccgtggcattgatgacctgggccctccacggtggcagctcaca
gcctgcctggtgctggtcattgttctgctctacttcagcctatggaagggagtaaagacc
tcagggaaggtggtgtggatcacagctaccatgccctatgtggtcctcacggccctgctc
ctgcgtggagttacccttcctggagccatggatggcatcagagcatacctcagtgtggac
ttctaccgactctgtgaggcatctgtgtggatcgatgctgccacccaggtgtgcttctcc
ctcggcgttgggtttggagtgctgattgccttctccagttacaataagttcaccaataac
tgctatagagacgcaatcatcaccacctccattaactccctgacaagcttctcctctggc
ttcgtcgtcttctccttcctggggtacatggcacagaagcacaatgtgcccatcagagat
gtggccacagatggacctgggctcatcttcatcatctatcctgaggcgatcgccacactc
ccgctgtcttctgcctgggctgctgtcttcttcctcatgctgctcactctgggtatcgac
agtgcaatggggggcatggagtcagtgatcactgggctcgtcgatgagttccagctgcta
catcggcatcgagagctcttcactcttggcattgtcctggctactttcctgctgtctctc
ttctgcgtcaccaacggtggcatctacgtcttcacactgctggaccactttgcagctggc
acatctatcctctttggcgtgctcattgaagccattggggtggcctggttctacggcgtc
cagcaattcagtgatgacatcaagcaaatgacagggcagcgacccaacctgtactggcgg
ctatgctggaagctggtcagcccctgcttcctcctgtatgtggtcgtggtcagcattgtg
accttcagacccccacactatggggcctacatcttcccagactgggccaatgccctgggc
tggatcatcgccacatcctccatggccatggtgcccatttatgcgacctacaagttctgc
agcctgccggggtccttccgggagaaactggcctatgccatcacacctgagaaagaccat
cagctagtggacagaggggaggtgcgccaattcacgctgcgtcactggctgttgctgtaa

DBGET integrated database retrieval system