KEGG   Rattus norvegicus (rat): 24899Help
Entry
24899             CDS       T01003                                 

Gene name
Smcp, Mcs, Mcsp
Definition
(RefSeq) sperm mitochondria-associated cysteine-rich protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 24899
NCBI-ProteinID: NP_113724
RGD: 3069
Ensembl: ENSRNOG00000009326
UniProt: Q64298
Position
2q34
AA seq 145 aa AA seqDB search
MSDSSKTNQCCPTPCCPPKPCCPPKPCCLQKSPCCPKSPCCPPKSPCCTPKVCPCPTPCP
CPATCPAACACPCPMKPCCPTKCTCCPKKCTCCPQPTCCVQPTCCSSENKTESDSDGSGQ
TQDRGAQTQQSPQGGQGNWNQKKTK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactcatccaaaaccaaccagtgctgccccactccatgctgcccaccaaaacca
tgttgcccacccaaaccgtgctgtctgcagaaatcaccttgctgtcccaagtccccatgc
tgtccacccaaatccccatgttgcacaccaaaggtctgtccctgtccgactccctgtccc
tgtccagccacctgtccagctgcctgtgcttgtccttgtccgatgaaaccatgctgccca
acgaagtgtacatgctgccctaaaaagtgcacctgctgcccacagcccacctgctgtgtt
caacccacctgctgctcttctgaaaacaagactgagtcagattctgatgggtctggtcaa
actcaggataggggtgctcaaacacagcagtcccctcaaggtggtcaaggcaattggaac
cagaagaagaccaagtaa

DBGET integrated database retrieval system