KEGG   Rattus norvegicus (rat): 24903
Entry
24903             CDS       T01003                                 

Gene name
Kng2
Definition
(RefSeq) T-kininogen 1 precursor
  KO
K03898  kininogen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    24903 (Kng2)
   04022 cGMP-PKG signaling pathway
    24903 (Kng2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24903 (Kng2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24903 (Kng2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24903 (Kng2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24903 (Kng2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24903 (Kng2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24903 (Kng2)
   05143 African trypanosomiasis
    24903 (Kng2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24903 (Kng2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24903 (Kng2)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   24903 (Kng2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24903 (Kng2)
  Exosomal proteins of other cancer cells
   24903 (Kng2)
SSDB
Motif
Pfam: Cystatin Cathelicidins SQAPI Spp-24 Bradykinin
Other DBs
NCBI-GeneID: 24903
NCBI-ProteinID: NP_036828
RGD: 2980
UniProt: Q5PQU1
Position
11
AA seq 430 aa
MKLITILLLCSRLLPSLAQEEGAQELNCNDETVFQAVDTALKKYNAELESGNQFVLYRVT
KGTKKDGAETLYSFKYQIKEGNCSVQSGLTWQDCDFKDAEEAATGECTTTLGKKENKFSV
ATQICNITPGKGPKKTEEDLCVGCFQPIPMDSSDLKPVLKHAVEHFNNNTKHTHLFALRE
VKSAHSQVVAGMNYKIIYSIVQTNCSKEDFPSLREDCVPLPYGDHGECTGHTHVDIHNTI
AGFSQSCDLYPGDDLFELLPKNCRGCPREIPVDSPELKEALGHSIAQLNAQHNHIFYFKI
DTVKKATSQVVAGVIYVIEFIARETNCSKQSKTELTADCETKHLGQSLNCNANVYMRPWE
NKVVPTVRCQALDMMISRPPGFSPFRLVRVQETKEGTTRLLNSCEYKGRLSKARAGPAPD
HQAEASTVTS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgaagctaattactatcctgctcctctgctccaggctcctgccaagtttagcgcaggaa
gaaggcgcccaggaattgaactgcaatgatgagactgtatttcaggctgtggatactgct
ctgaagaaatataacgctgagttagaaagcggcaaccagtttgtgttgtaccgagtgact
aagggcactaagaaggatggcgctgaaacattgtattccttcaagtatcaaatcaaggag
ggcaactgctctgttcagagtggcctcacctggcaggactgtgacttcaaggacgctgag
gaagccgctactggcgaatgcacaacaactttggggaagaaagaaaataaattctccgta
gccacccagatctgcaatattactccaggtaagggtcctaagaagacagaggaggacctc
tgtgtcgggtgtttccaacccataccgatggatagctcagacctgaagcctgttctgaaa
cacgctgtggagcatttcaacaacaacacgaagcacacccacctctttgctctcagagaa
gtaaagagtgcccactcacaggtggtggctggcatgaattataaaattatctactccatt
gtgcaaacaaattgttcaaaggaggattttccttccctccgtgaagactgtgtacccctt
ccctatggcgatcatggtgagtgtacgggtcatacccacgtggatattcataacacaatt
gccggcttctcacagagctgtgacctttatccaggagatgatttgtttgaactacttccc
aagaattgccgtggctgccccagggagatacctgtagacagcccggagctgaaggaggca
cttggtcattccattgcacagcttaatgcacagcataaccatattttctatttcaagatt
gacaccgtgaaaaaggcaacatcacaggtggttgctggagtaatatatgtgattgagttc
atagccagagaaactaactgttccaagcaaagtaaaacagaactgacagcggattgtgag
accaaacacctcggtcaaagcctcaactgcaatgctaacgtgtacatgagaccttgggag
aacaaagtcgtcccgactgtcagatgccaagcactagatatgatgatttctaggcctcca
ggattttcacctttccggctggtgcgagtacaagaaactaaagaaggaacaactaggctc
ctaaactcatgtgagtacaagggcagactctcaaaggcaagggcaggcccagcacctgac
catcaggcagaagcttcaaccgtgacatcatag

KEGG   Rattus norvegicus (rat): 25087
Entry
25087             CDS       T01003                                 

Gene name
Kng2l1
Definition
(RefSeq) kininogen-1 isoform 1 precursor
  KO
K03898  kininogen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    25087 (Kng2l1)
   04022 cGMP-PKG signaling pathway
    25087 (Kng2l1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25087 (Kng2l1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25087 (Kng2l1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25087 (Kng2l1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25087 (Kng2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25087 (Kng2l1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    25087 (Kng2l1)
   05143 African trypanosomiasis
    25087 (Kng2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25087 (Kng2l1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25087 (Kng2l1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   25087 (Kng2l1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   25087 (Kng2l1)
  Exosomal proteins of other cancer cells
   25087 (Kng2l1)
SSDB
Motif
Pfam: Cystatin Cathelicidins SQAPI Spp-24 RpoY
Other DBs
NCBI-GeneID: 25087
NCBI-ProteinID: NP_036873
RGD: 1594590
UniProt: P08934
Position
11
AA seq 639 aa
MKLITILLLCSRLLPSLAQEEDAQEMDCNDESLFQAVDTALKKYNAGLKSGNQFVLYQVT
EGTKKDGSKTFYSFKYQIKEGNCSVQSGFAWQDCDFKDAEEAATGECTATLEKRRNNKFS
IATQICNITPGKGPIVTNEYHCLGCMHPISVDSPELGPVLKHAVEHFNNNTKHTHLFALG
EVKSADRQVVAGMNYQIIYSIVQTNCSKEDFPSLHEDCVPLPSGDDGECKGNAFVDIHKT
IAGFSDSCEFYPGDDLFELLPEDCPGCPRNIPVDSPELKEALGHSIAQLNAENNHTFYFK
IDTVKKATSQVVAGTKYVIEFIARETKCSKESNAELTADCETKRLGQSLNCNANVYMRPW
ENKVVPTVKCKVLDMTSVIRRPPGFSPFRAPRVKKPKESTTVSPSYIARVQEERDPGNEQ
GPIHGHGWLHAKQIKNKNHQGHKHGHGIGHGHQKPHGLGHGHQLKLDDLKQQREDGYDHR
HPVGHGHGQRHGHGHGHGHGRDKHTNKDKNNVKHTDQRRAPLTSSSEDNTTSTQIQGRTE
GFTLNPPLAQPAVISRGFQDSGFTEGVIATTSPYDTETHDDLIPDIHVQPDSLSFKLISD
FPEATSHKCPGRPWKPVSRKDPTIETTEFSDFDLLDALS
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgaagctaattactatcctgctcctctgctccaggctcctgccaagtttagcgcaggaa
gaagatgcccaggaaatggactgcaatgatgagagtctttttcaggctgtggatactgct
ctgaagaaatataatgctgggttaaaaagtggcaaccagtttgtgttgtaccaagtgact
gagggcactaagaaggatggctctaaaacattttattccttcaagtatcaaatcaaggag
ggaaactgctctgttcagagtggcttcgcctggcaggactgcgacttcaaggacgctgag
gaagccgctactggtgaatgcacagcaactttggagaagagaagaaataataaattctcc
atagccacccagatctgcaatattactccgggtaagggtcccatagtgacaaacgagtac
cactgtctggggtgtatgcaccctatctcggtggatagcccagagttggggcctgttctg
aaacacgctgtggagcatttcaacaacaacacgaagcacacccacctctttgctctcgga
gaagtaaagagtgctgacagacaggtggtagctggcatgaattatcaaattatctactcc
attgtgcaaacaaattgttcaaaggaggattttccttccctccatgaagactgcgtgccc
cttcccagtggtgatgatggtgaatgtaagggtaatgccttcgtggatattcataaaaca
attgccggcttctcagacagctgtgaattttatccaggagatgatttgttcgaactactt
cctgaggattgccctggctgccccagaaacatacctgtagacagcccagagctgaaggag
gcacttggtcattccattgcacaacttaatgcagagaataaccatactttctatttcaag
attgacaccgtgaaaaaggcaacatcacaggtggttgctggaacaaaatatgtgattgag
ttcatagccagagaaaccaaatgttccaaggaaagtaacgcagaactgacagcagattgt
gagaccaaacgcctcggtcaaagcctcaactgcaatgctaacgtgtacatgagaccttgg
gagaacaaagtcgtcccgactgtcaaatgcaaagtactagacatgacatcagtgataaga
aggcctccaggattttcacctttccgggcacctcgagtgaaaaagcctaaagaaagtaca
actgtaagtccatcctacattgccagggtgcaagaagagagggatccaggaaatgaacaa
ggacccatccatgggcatggctggttgcatgcaaagcaaataaagaataagaatcaccaa
ggtcataagcatgggcatggtattggccatggacaccagaaaccacatggccttggtcat
ggacatcaacttaaacttgatgatcttaaacagcaaagggaagacggctatgaccataga
catccagtgggacatggtcatggtcagaggcatggtcatggtcatggtcatggtcacggt
cgtgataaacacacaaataaagacaaaaacaatgtcaagcacactgaccagagaagagca
cctttgacaagctcttctgaagacaatactacatctacacagatacaggggaggacagag
ggcttcaccttgaaccctcccctagctcagccagctgttatctctcgtggttttcaggac
tcaggtttcactgaaggtgtgatagctaccacatcaccatatgacacggagacccatgat
gatttgatccctgatatccatgtacaaccagatagcctttcatttaagctgatatctgac
tttccagaagcaacttcccacaagtgtcctgggcgcccatggaagccagttagtaggaag
gatccaaccatagaaacaacagaattttctgattttgatctcctcgatgctctttcttaa

KEGG   Rattus norvegicus (rat): 288001
Entry
288001            CDS       T01003                                 

Gene name
Kng1
Definition
(RefSeq) T-kininogen 2 precursor
  KO
K03898  kininogen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    288001 (Kng1)
   04022 cGMP-PKG signaling pathway
    288001 (Kng1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    288001 (Kng1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    288001 (Kng1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    288001 (Kng1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    288001 (Kng1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    288001 (Kng1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    288001 (Kng1)
   05143 African trypanosomiasis
    288001 (Kng1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    288001 (Kng1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    288001 (Kng1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   288001 (Kng1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   288001 (Kng1)
  Exosomal proteins of other cancer cells
   288001 (Kng1)
SSDB
Motif
Pfam: Cystatin Cathelicidins SQAPI Spp-24 Bradykinin
Other DBs
NCBI-GeneID: 288001
NCBI-ProteinID: NP_001009628
RGD: 1359376
Ensembl: ENSRNOG00000030387
UniProt: P08932
Position
11
AA seq 430 aa
MKLITILLLCSRLLPSLAQEEGAQEMDCNDETVFQAVDTALKKYNAELESGNQFLLYRVT
EGTKKDGAETLYSFKYQIKEGNCSVQSGLTWQDCDFKDAEEAATGECTTTLGKKENKFSV
ATQICNITPGKGPKKTEEDLCVGCFQPIPMDSSDLKPVLKHAVEHFNNNTKHTHLFALTE
VKSAHSQVVAGMNYKIIYSIVQTNCSKEDFPFLREDCVPLPYGDHGECRGHTYVDIHNTI
AGFSQSCDLYPGDDLFSLLPKKCFGCPKNIPVDSPELKEALGHSIAQLNAQHNHLFYFKI
DTVKKATSQVVAGTKYVIEFIARETNCSKQTNTELTADCETKHLGQSLNCNANVYMRPWE
NKVVPTVRCQALDMMISRPPGFSPFRLVQVQETKEGTTRLLNSCEYKGRLSKAGAGPAPD
HQAEASTVTP
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgaagctaattactatcctgctcctctgctccaggctcctgccaagtttagcgcaggaa
gaaggtgcccaggaaatggactgcaatgatgagactgtatttcaggctgtggatactgct
ctgaagaaatataatgctgagttagaaagtggcaaccagtttctgttgtaccgagtgact
gagggcactaagaaggatggcgctgaaacattgtattccttcaagtatcaaatcaaggag
ggcaactgctctgttcagagtggcctcacctggcaggactgtgacttcaaggacgctgag
gaagctgctactggcgaatgcacaacaactttggggaagaaagaaaataaattctccgta
gccacccagatctgcaatattactccaggtaagggtcctaagaagacagaggaggacctc
tgtgtcgggtgtttccaacccataccgatggatagctcagacctgaagcctgttctgaaa
cacgctgtggagcatttcaacaacaacacgaagcacacccacctctttgctctcacagaa
gtaaagagtgcccactcacaggtggtggctggcatgaattataaaattatctactccatt
gtgcaaacaaattgttcaaaggaggattttcctttcctccgtgaagactgtgtacccctt
ccctatggcgatcatggtgagtgtaggggtcatacctacgtggatattcataacacaatt
gctggcttctcacagagctgtgacctttatccaggagacgatttgttttcactacttccc
aagaaatgctttggctgccccaagaacatacctgtagacagcccggagctcaaggaggca
cttggtcattcaattgcacagcttaatgcacagcataatcatcttttctatttcaagatt
gacaccgtgaaaaaggcaacatcacaggtggttgctggaacaaaatatgtgattgagttc
atagccagagaaaccaattgttccaaacaaactaacacagaactgacagcggactgtgag
accaaacacctcggtcaaagcctcaactgcaatgctaacgtgtacatgagaccttgggag
aacaaagtcgtcccgactgtcagatgccaagcgctagacatgatgatttctaggcctcca
ggattttcacctttccggctggtgcaagtacaagaaactaaagaaggaacaactaggctc
ctaaactcatgtgagtacaagggcagactctcaaaggcaggggcaggcccagcgcctgac
catcaggcagaagcttcaaccgtgacaccatag

DBGET integrated database retrieval system