KEGG   Rattus norvegicus (rat): 24904
Entry
24904             CDS       T01003                                 

Gene name
Slc22a1, Oct1, Orct1, Roct1
Definition
(RefSeq) solute carrier family 22 member 1
  KO
K08198  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    24904 (Slc22a1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    24904 (Slc22a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24904 (Slc22a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   24904 (Slc22a1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    24904 (Slc22a1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12
Other DBs
NCBI-GeneID: 24904
NCBI-ProteinID: NP_036829
RGD: 3224
Ensembl: ENSRNOG00000016337
UniProt: Q63089
Position
1q11
AA seq 556 aa
MPTVDDVLEQVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFTPGHYCQNPGVAELSQ
RCGWSQAEELNYTVPGLGPSDEASFLSQCMRYEVDWNQSTLDCVDPLSSLVANRSQLPLG
PCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLGSLVVGYIADRFGRKLCL
LVTTLVTSVSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAIL
YQMAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFLFLLYYWFVPESPRWLLSQKRTTRAV
RIMEQIAQKNGKVPPADLKMLCLEEDASEKRSPSFADLFRTPNLRKHTVILMYLWFSCAV
LYQGLIMHVGATGANLYLDFFYSSLVEFPAAFIILVTIDRIGRIYPIAASNLVTGAACLL
MIFIPHELHWLNVTLACLGRMGATIVLQMVCLVNAELYPTFIRNLGMMVCSALCDLGGIF
TPFMVFRLMEVWQALPLILFGVLGLTAGAMTLLLPETKGVALPETIEEAENLGRRKSKAK
ENTIYLQVQTGKSSST
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgcccaccgtggatgatgtcctggagcaagttggagagtttggctggttccagaaacaa
gccttcctgttgctatgcctgatctcagcttctttagctcccatctatgtgggcatcgtc
ttcctgggcttcacccctggacattattgccagaatcctggggtggctgagctgagccag
cggtgtggctggagccaggcagaggagctgaactacactgtgccgggcctgggaccttcg
gacgaggcctccttcctcagccagtgcatgaggtatgaggtggactggaaccagagcacc
cttgactgtgtggacccactgtccagcctggttgccaacaggagtcagttgccattgggc
ccctgcgagcatggctgggtatacgacactcccggctcctccatcgtcactgagtttaac
ctggtgtgtggagacgcctggaaagtggacctttttcagtcctgtgtgaacttgggcttc
ttcctgggctccctggttgtgggttacattgcagacaggtttggccgtaagctctgtctc
ttggtgaccacgctggtcacatctgtgtccggtgtgctaacagcggtggccccagactat
acatccatgttgctctttcgcctgctgcagggcatggtcagcaagggcagctgggtgtcc
ggctataccttgatcacagagtttgtcggctctggctacaggagaacgacggccattttg
taccagatggccttcacagtggggctagtggggcttgccggggtggcctatgccattcca
gactggcgctggctccagctagctgtgtccctgcctaccttcctcttcctgctgtattac
tggtttgtcccagaatccccccggtggctgttgtcccagaagagaaccacgcgagctgtc
aggataatggagcaaattgcacagaagaacgggaaggtgcctcctgctgacctgaagatg
ctctgccttgaggaggatgcctcagaaaagcgaagtccttcgtttgccgacctgttccgc
actcccaacctgaggaagcacaccgtcatcctgatgtatctatggttctcttgtgctgtg
ctgtaccagggtctcatcatgcacgtgggagccacaggggccaacctctacctggacttc
ttttattcttctctggtggaattccccgcggccttcatcatcctggtcaccattgaccgc
attggccgcatctacccaatagcggcctcgaatctggtgacgggggcagcctgcctcctc
atgatctttatcccgcatgagctgcactggttgaacgttaccctcgcctgtcttggccgt
atgggggccaccattgtgctgcagatggtctgcctggtgaacgctgagctgtaccctaca
ttcatcaggaatcttgggatgatggtatgctctgccctgtgtgacctgggtgggatcttc
acccccttcatggtgttcaggctgatggaagtttggcaagccctgcccctcattttgttt
ggggttttgggcctgactgctggggccatgactcttcttctcccagagaccaagggtgtg
gctttgcctgagactattgaagaagcagagaacctggggaggaggaaatcaaaggccaaa
gaaaacacgatttaccttcaggtccaaacaggcaagtcctcaagtacctga

DBGET integrated database retrieval system