KEGG   Rattus norvegicus (rat): 24907
Entry
24907             CDS       T01003                                 

Gene name
Dmd
Definition
(RefSeq) dystrophin isoform Dp71ab
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: EF-hand_2 EF-hand_3 ZZ Miff SOGA bZIP_1 YabA LRRFIP HALZ
Other DBs
NCBI-GeneID: 24907
NCBI-ProteinID: NP_001005244
RGD: 2507
Ensembl: ENSRNOG00000046366
Vega: OTTRNOG00000001358
UniProt: Q7TPH3
Position
X
AA seq 622 aa
MREHLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSA
ACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDT
GRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQL
GEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGED
VRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHDDTHSRIEHYA
SRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESE
ERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAE
AKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRS
DSSQPMLLRVVGSQTSESMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHM
ADDLGRAMESLVSVMIDEEGAE
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgagggaacacctcaaaggccacgagacccaaacaacttgttgggaccatcccaaaatg
acagagctctaccagtctttagctgacctgaataatgtcaggttctccgcttataggact
gccatgaagctcagaagactccagaaggccctttgcttggatctcttgagcctgtcagct
gcatgtgacgccttggaccagcacaacctcaagcaaaatgatcagcccatggatatcctg
cagataattaactgtttgactactatttatgaccgtctggagcaagagcacaacaatttg
gtcaatgtccctctctgtgtggatatgtgtctcaactggcttctcaatgtttatgatacg
ggacgaacagggaggatccgtgtcctgtcttttaaaactggcatcatttctctgtgtaaa
gcacacttggaagacaagtacagataccttttcaagcaagtggcaagttcaaccggcttt
tgtgaccagcgtagactgggtcttcttctgcatgattctattcaaatcccaagacagttg
ggtgaagttgcctcctttgggggcagtaacattgagccgagtgtcaggagctgtttccag
tttgccaataataaacctgagattgaagccgctctcttccttgactggatgcgtctggaa
ccccagtctatggtgtggctgccggtcttgcacagagtggctgctgctgaaacagccaag
catcaggccaagtgtaacatctgtaaggagtgtccaatcattggattcaggtacagaagc
ctgaaacactttaattatgacatctgccaaagctgctttttttctggccgagttgctaag
ggccataaaatgcactaccccatggtagagtactgcactccgactacatctggagaagat
gttcgtgactttgccaaggtactgaaaaacaaatttcgaaccaaaaggtattttgcgaag
catccccgaatgggctaccttccagtgcagactgtgttagagggggacaacatggaaacg
cctgcctcgtccccccagctttcacacgatgatactcattcacgcattgagcattatgct
agcaggctagcagaaatggaaaacagcaatggatcttatctaaatgatagcatctctcct
aatgagagcatagatgatgaacatttgttaatccagcattactgccaaagtttgaaccag
gactcccccctgagccagcctcgtagtcctgcccagatcttgatttccttagagagtgag
gaaagaggggagctagagagaatcctagcagatcttgaggaagaaaacagaaatctgcaa
gcagaatatgatcgtctgaagcagcagcatgagcataaaggcctgtccccactgccgtct
cctcctgagatgatgcccacctctccccagagtcccagggatgctgaactcattgctgag
gccaagctactgcgccaacacaaaggacgtctggaagccaggatgcaaatcctggaagac
cacaataaacaactggagtctcagttacatagactgaggcagctcctggagcaaccccag
gctgaggccaaggtgaatggcaccacggtgtcctctccttctacctcgctgcagaggtca
gatagcagtcagcctatgctgctccgagtggttggcagtcaaacttcagaatctatgggt
gaggaagatcttctgagtcctccccaggacacaagcacagggttagaagaagtgatggag
caactcaacaactccttccctagttcaagaggacacaatgtaggaagccttttccacatg
gcagatgatttgggcagagcgatggagtccttagtttcagtcatgatagatgaagaagga
gcagaataa

DBGET integrated database retrieval system