KEGG   Rattus norvegicus (rat): 24908Help
Entry
24908             CDS       T01003                                 

Gene name
Dnajb9, Mdg1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B9
  KO
K09515  DnaJ homolog subfamily B member 9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    24908 (Dnajb9)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   24908 (Dnajb9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ SNRNP27
Motif
Other DBs
NCBI-GeneID: 24908
NCBI-ProteinID: NP_036831
RGD: 3070
Ensembl: ENSRNOG00000004006
UniProt: P97554
Position
6q21
AA seq 222 aa AA seqDB search
MATPQSVFVFAICILMITELILASKNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKS
PDAEAKFREIAEAYETLSDANRRKEYDIIGHSAFTNGKGQRSNGSPFEQSFNFNFDDLFK
DFNLFGQNQNTRSKKHFENHFQTRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSG
FDSTNRRTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcaactccacagtcagttttcgtctttgccatctgcattctaatgataacagaatta
atcctggcctcaaaaaactactatgatatcttaggtgtgccaaagtcagcctcagagaga
caaatcaaaaaggcctttcacaaattagccatgaagtaccaccctgataaaaataaaagc
cctgatgctgaagcaaaattcagagagattgcagaagcatatgaaacactctcggatgcc
aatagacggaaagagtatgatataattggacacagtgcttttactaatggcaaaggacaa
agaagcaatggaagtccttttgagcagtcatttaacttcaattttgatgacttatttaaa
gactttaatttgtttggtcagaaccagaacactcggtctaagaagcattttgaaaatcac
ttccagacacgccaggatggttccagtagacaaaggcatcacttccaggagttttctttt
ggaggtggattgtttgatgatatgtttgaagacatggagaagatgttttcttttagtggc
tttgatagcaccaatcgacgcacagtacagactgaaaatagatttcatggatccagcaag
cactgcaggaccgtcactcagcggagagggaatatggttactacgtacaccgactgttca
ggacagtag

DBGET integrated database retrieval system