KEGG   Rattus norvegicus (rat): 24912
Entry
24912             CDS       T01003                                 

Gene name
Sult2a1
Definition
(RefSeq) sulfotransferase 2A1
  KO
K11822  bile-salt sulfotransferase [EC:2.8.2.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00980  Metabolism of xenobiotics by cytochrome P450
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24912 (Sult2a1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    24912 (Sult2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    24912 (Sult2a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.14  bile-salt sulfotransferase
     24912 (Sult2a1)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 UPF0270
Other DBs
NCBI-GeneID: 24912
NCBI-ProteinID: NP_571978
RGD: 621337
Ensembl: ENSRNOG00000047986
UniProt: P15709
Position
1
AA seq 284 aa
MPDYTWFEGIPFHAFGISKETLQNVCNKFVVKEEDLILLAYPKSGTNWLIEIVCLIQTKG
DPKWIQSVTIWDRSPWIETDVGYDILIKKKGPRLMTSHLPMHLFSKSLFSSKAKVIYLIR
NPRDVLVSGYYFWGNSTLVKKPDSLGTYVEWFLKGNVLYGSWFEHIRAWLSMREWDNFLL
LYYEDMKKDTMGTIKKICDFLGKKLEPDELDLVLKYSSFQVMKENDMSNYSLLMKKSIFT
GIGLMRKGTIGDWKNHFTVSQAEAFDKVFQEKMAGFPPGMFPWE
NT seq 855 nt   +upstreamnt  +downstreamnt
atgccagactatacttggtttgaaggaataccttttcatgcctttgggatttcaaaagaa
actttgcaaaatgtttgtaataagtttgtggtgaaagaagaagatttgattttattggct
tatcccaagtcaggaacgaactggctgattgaaattgtctgcttgattcagaccaaggga
gatcccaagtggatccaatctgtgactatctgggatcgctcaccctggatagagactgat
gtaggatatgatatattaatcaaaaagaaaggaccacgactcatgacctcccatcttccc
atgcatcttttctccaagtctctcttcagttccaaggccaaggtgatctatctcatcaga
aatcccagagatgttcttgtttctggttattatttctggggtaattcaactcttgtgaag
aagccagactcactgggaacttatgttgaatggttcctcaaaggaaatgttctatatgga
tcatggtttgagcacatccgtgcctggctgtccatgcgagaatgggacaacttcttgtta
ctgtactatgaagacatgaaaaaggatacaatgggaaccataaagaagatatgtgacttc
ctggggaaaaaattagagccagatgagctggatttggtcctcaagtatagttccttccaa
gtcatgaaagaaaatgacatgtccaattatagcctcctgatgaaaaaatcaatttttact
ggaattggcctcatgaggaaaggcactattggggactggaagaatcacttcactgtatcc
caagctgaagcctttgataaagtgtttcaggagaaaatggccggtttccctccagggatg
ttcccatgggaataa

DBGET integrated database retrieval system