KEGG   Rattus norvegicus (rat): 24915
Entry
24915             CDS       T01003                                 

Gene name
Pdlim4
Definition
(RefSeq) PDZ and LIM domain protein 4
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    24915 (Pdlim4)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   24915 (Pdlim4)
SSDB
Motif
Pfam: PDZ LIM DUF4749 PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 24915
NCBI-ProteinID: NP_058758
RGD: 3575
Ensembl: ENSRNOG00000050794
UniProt: P36202
Position
10
AA seq 330 aa
MTHAVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDSIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPENKNWPSSPNDKAQAHRIHIDPEAQDGSPATSRRSSI
SGISLEDNRSGLGSPYGQPPRLPVPHNGSSNEVTLPSQMSALHVSPPPSADTPRILPRNR
DCRVDLGSEVYRMLREPAEPAASEPKQSGSFRYLQGMLEAGEGGDRPGSGGSRNLKPAAS
KLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCENHAKARVKPPEGYDVVAVYPNAKVELV
NT seq 993 nt   +upstreamnt  +downstreamnt
atgacccacgcggtgaccctgcgcggcccttcaccctggggcttccgcctggtgggcggc
cgtgacttcagtgcccccctcaccatctcgcgggttcatgctgggagcaaagcggccctg
gctgccctgtgcccaggtgactcgatccaagccatcaacggtgagagcactgagctcatg
acacacctggaggcccagaaccgcattaaaggctgccacgatcaccttacactctcagta
agcaggcctgagaacaagaactggcccagttcccctaatgacaaggcccaagcgcatagg
atccacattgaccctgaggcccaggatggcagcccagccaccagcaggcggtcctcaatc
tctggaattagtctggaggacaacagatcgggcctgggatctccgtatggccagccacct
cgccttccagttcctcacaatggcagcagcaatgaggtcaccctgccatcccagatgagc
gctctgcatgtgtctccaccccccagtgctgacacacccaggattctccctcggaaccgg
gactgcagggtggacctgggttcagaggtatacaggatgttaagggagccagcagagcca
gcagcctcagagcccaaacagtctggatccttccgctacttgcaaggcatgctagaggct
ggcgaaggcggggatcggcctgggtctggtggttcccggaacctcaagccagcagccagc
aagctgggtgctccactgagtggcctgcaggggttaccagagtgcacacgctgtggccac
gggatcgtgggaaccatcgtcaaggcgagggacaagctctaccatcccgagtgcttcatg
tgtagcgactgtggcctgaatctcaagcagcgtgggtacttcttcctagacgaacggctg
tactgcgagaaccatgccaaggctcgagtcaagccaccggagggatatgacgtggtggct
gtatatcccaatgccaaggtggaacttgtctga

DBGET integrated database retrieval system