KEGG   Rattus norvegicus (rat): 24924Help
Entry
24924             CDS       T01003                                 

Gene name
Ptn, HARP, Hbnf
Definition
(RefSeq) pleiotrophin
  KO
K16642  pleiotrophin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24924 (Ptn)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   24924 (Ptn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTN_MK_C PTN_MK_N
Motif
Other DBs
NCBI-GeneID: 24924
NCBI-ProteinID: NP_058762
RGD: 3444
Ensembl: ENSRNOG00000011946
UniProt: P63090
Position
4q22
AA seq 168 aa AA seqDB search
MSSQQYQQQRRKFAAAFLALIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccagcaataccagcagcaacgtcgaaaatttgcagctgccttcctggctttg
attttcatcctggcagccgtggacactgctgaggccgggaaaaaagagaaaccagaaaaa
aaggtgaaaaaatctgactgtggagaatggcaatggagtgtgtgcgtgcccaccagcggg
gactgtggtctaggcacccgggagggcactcgcactggtgccgagtgcaaacaaaccatg
aagactcagagatgtaagatcccttgcaactggaagaagcagtttggagctgagtgcaaa
taccagttccaggcttggggagaatgtgacctcaataccgccttgaagaccagaactggc
agtctgaagagagctctgcacaatgccgactgtcagaaaactgtcaccatctccaagccc
tgtggcaaactcaccaagcccaagcctcaagcggaatcaaagaagaagaaaaaggaaggc
aagaaacaggagaagatgctggattaa

DBGET integrated database retrieval system