KEGG   Rattus norvegicus (rat): 24929
Entry
24929             CDS       T01003                                 

Gene name
Ptger3
Definition
(RefSeq) prostaglandin E2 receptor EP3 subtype
  KO
K04260  prostaglandin E receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04923  Regulation of lipolysis in adipocytes
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24929 (Ptger3)
   04024 cAMP signaling pathway
    24929 (Ptger3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24929 (Ptger3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    24929 (Ptger3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24929 (Ptger3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    24929 (Ptger3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24929 (Ptger3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    24929 (Ptger3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srbc DUF2207
Other DBs
NCBI-GeneID: 24929
NCBI-ProteinID: NP_036836
RGD: 3435
Ensembl: ENSRNOG00000010325
UniProt: P34980 A0A0G2JSK4
Position
2
AA seq 362 aa
MAGVWAPEHSVEAHSNQSSAADGCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLSVLAFALLPVLGVGRYSVQW
PGTWCFISTGPAGNETDSAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAK
AAASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEK
ECNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQMMNNLKRSFIAIPASLSMRISSPR
EG
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggccggcgtgtgggcgccggagcactcggttgaagcgcacagcaaccagtcaagtgct
gccgacggctgcggctctgtgtccgtggccttccccatcaccatgatggtcactggcttc
gtgggcaacgcgctggccatgttgcttgtgtcgcgcagctatagacgccgggagagcaaa
cgcaaaaagtctttcctgctgtgcattggctggctggcgctcaccgacttggtggggcag
ctcctgaccagtccggtggtcatcctcgtgtacctgtcgcagcgacgctgggagcaactc
gacccatcggggcgcctgtgcaccttcttcgggctgaccatgacagtgttcggactgtcc
tcgctcttggtggccagcgccatggccgtggagcgcgccctggctatccgtgcgccgcac
tggtatgccagccacatgaagactcgcgccacgcgcgcggtactgctgggtgtgtggctg
tctgtgctcgccttcgcgctgctgcctgtgctgggcgtgggccgctacagcgtgcagtgg
cccggcacgtggtgcttcatcagcaccgggccggcgggcaacgagacggactctgcgcgg
gagccgggcagcgtggcctttgcctccgccttcgcctgtctaggcttgctggctctggtg
gtgacctttgcctgcaacctggcgaccatcaaagccctggtgtcccgctgccgggccaaa
gccgccgcctcgcagtccagcgcccagtggggccggatcaccacggagacggctatccag
cttatggggatcatgtgtgtactgtccgtctgctggtcgccgctattgataatgatgctg
aaaatgatcttcaatcagatgtcagtagagcaatgcaagacgcagatgggaaaggagaag
gagtgcaattccttcctaatcgccgttcgcctggcttcgctgaaccagatcttggatccc
tgggtttatctgctgctaagaaagatccttcttcgaaagttctgccagatgatgaacaac
ctgaagcggagtttcattgcaatacctgcttccctgagtatgagaatttcttcccccagg
gaaggataa

KEGG   Rattus norvegicus (rat): 25637
Entry
25637             CDS       T01003                                 

Gene name
Ptger1
Definition
(RefSeq) prostaglandin E2 receptor EP1 subtype
  KO
K04258  prostaglandin E receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25637 (Ptger1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25637 (Ptger1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25637 (Ptger1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25637 (Ptger1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25637 (Ptger1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    25637 (Ptger1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 25637
NCBI-ProteinID: NP_001265404
RGD: 3434
Ensembl: ENSRNOG00000004094
UniProt: P70597
Position
19
AA seq 405 aa
MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFSMTLGAVSNVLALALLA
QVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV
FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALALLAAMALAVALLPLVHVGH
YELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR
SRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALRSSRGGGSARRVHAHDVEMVG
QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA
MLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSRHSGFSHL
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgagcccctacgggcttaacctgagcctagtggatgaggcaacaacgtgtgtaacaccc
agggtccccaatacatctgtggtgctgccaacaggcggtaacggcacatcaccagcgctg
cctatcttctccatgacgctgggtgctgtgtccaacgtgctggcgctggcgctgctggcc
caggttgcaggcagactgcggcgccgccgctcgactgccaccttcctgttgttcgtcgcc
agcctgcttgccatcgacctagcaggccatgtgatcccgggcgccttggtgcttcgcctg
tatactgcaggacgtgcgcccgctggcggggcctgtcatttcctgggcggctgcatggtc
ttctttggcctgtgcccacttttgcttggctgtggcatggccgtggagcgctgcgtgggt
gtcacgcagccgctgatccacgcggcgcgcgtgtccgtagcccgcgcacgcctggcacta
gccctgctggccgccatggctttggcagtggcgctgctgccactagtgcacgtgggtcac
tacgagctacagtaccctggcacttggtgtttcattagccttgggcctcctggaggttgg
cgccaggcgttgcttgcgggcctcttcgccggccttggcctggctgcgctccttgccgca
ctagtgtgtaatacgctcagcggcctggcgctccttcgtgcccgctggaggcggcgtcgc
tctcgacgtttccgagagaacgcaggtcccgatgatcgccggcgctgggggtcccgtgga
ctccgcttggcctccgcctcgtctgcgtcatccatcacttcaaccacagctgccctccgc
agctctcggggaggcggctccgcgcgcagggttcacgcacacgacgtggaaatggtgggc
cagctcgtgggcatcatggtggtttcgtgcatctgctggagccccctgctggtattggtg
gtgttggccatcgggggctggaactctaactccctgcagcggccgctctttctggctgta
cgcctcgcgtcgtggaaccagatcctggacccatgggtgtacatcctgctgcgccaggct
atgctgcgccaacttcttcgcctcctacccctgagggttagtgccaagggtggtccaacg
gagctgagcctaaccaagagtgcctgggaggccagttcactgcgtagctcccggcacagt
ggcttcagccacttgtga

KEGG   Rattus norvegicus (rat): 81752
Entry
81752             CDS       T01003                                 

Gene name
Ptger2
Definition
(RefSeq) prostaglandin E2 receptor EP2 subtype
  KO
K04259  prostaglandin E receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04750  Inflammatory mediator regulation of TRP channels
rno04924  Renin secretion
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    81752 (Ptger2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81752 (Ptger2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    81752 (Ptger2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81752 (Ptger2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81752 (Ptger2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    81752 (Ptger2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    81752 (Ptger2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    81752 (Ptger2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 81752
NCBI-ProteinID: NP_112350
RGD: 620020
Ensembl: ENSRNOG00000050968
UniProt: Q62928
Position
15
AA seq 357 aa
MDNSFNDSRRVENCESRQYLLSDESPAISSVMFTAGVLGNLIALALLARRWRGDTGCSAG
SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESRACTYFAFTMTFF
SLATMLMLFAMALERYLAIGHPYFYRRRVSRRGGLAVLPAIYGVSLLFCSLPLLNYGEYV
QYCPGTWCFIQHGRTAYLQLYATVLLLLIVAVLGCNISVILNLIRMQLRSKRSRCGLSGS
SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAVCSLPFTIFAYMDETSSRKEKWDLRA
LRFLSVNSIIDPWVFVILRPPVLRLMRSVLCCRTSLRAPEAPGASCSTQQTDLCGQL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggacaattctttcaatgactccaggcgagtggagaactgcgagagtcgtcagtatctc
ctttcggacgaaagcccagccatcagctcggtgatgttcacggccggggttctgggaaac
ctcatcgcgctggcactgttggcgcgccgctggcgtggggacacggggtgtagcgccggc
agcaggacctctatctccttgttccacgtgctggtaacggaactggtgctcaccgacctg
ctggggacctgcctcataagcccggtggtgctggcttcttattcgagaaaccagacccta
gtggccctggctcccgaaagccgcgcgtgtacctatttcgctttcactatgaccttcttt
agtctggccacgatgctcatgctcttcgccatggccctggaacgctacctcgccatcgga
cacccttacttctacaggcgccgcgtctctcgccgcgggggtttggcggtgctgcctgcc
atctatggggtctccttgctcttctgttctctgccgctgctcaactacggggagtacgtc
cagtactgtcctgggacgtggtgctttatccagcacgggaggaccgcataccttcagctg
tacgccacggtgctcctgctgctcatcgtggctgtgctcggctgcaacatcagcgtgatc
ctcaaccttattcgcatgcagcttcggagcaaaagaagccgctgcggattgtctggcagt
agcctgagaggccccgggtctcgccggagaggagaaaggacttctatggcggaggagacg
gaccacctcattctcctggccattatgaccatcaccttcgctgtatgctccctgcctttc
acaatctttgcttatatggatgaaacctcttcccgaaaggaaaagtgggacctccgagct
cttagatttttatcagtgaactccataattgatccttgggtttttgtcatccttagacca
ccagtcctgagactaatgcgctcagtcctctgttgtcggacttcactgagagcaccggaa
gctccaggagcttcctgttcgacccagcagacggacctctgcggacagttgtga

KEGG   Rattus norvegicus (rat): 84023
Entry
84023             CDS       T01003                                 

Gene name
Ptger4
Definition
(RefSeq) prostaglandin E2 receptor EP4 subtype
  KO
K04261  prostaglandin E receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04750  Inflammatory mediator regulation of TRP channels
rno04924  Renin secretion
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    84023 (Ptger4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    84023 (Ptger4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    84023 (Ptger4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84023 (Ptger4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    84023 (Ptger4)
   05165 Human papillomavirus infection
    84023 (Ptger4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    84023 (Ptger4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    84023 (Ptger4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL
Other DBs
NCBI-GeneID: 84023
NCBI-ProteinID: NP_114465
RGD: 628641
Ensembl: ENSRNOG00000013240
UniProt: P43114 A0A0G2JSM6
Position
2
AA seq 488 aa
MSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSIICAMSIERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGRSERQYPGTWCFIDWTTNVTA
YAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAAAVASVA
CRGHAAASPALQRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFINQL
YQPSVVKDISRNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSGRD
GSAQHCSESRRTSSAMSGHSRSFLSRELREISSTSQTLLYLPDLTESSLGGKNLLPGTHG
MGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSQREEPASKGNSLQVTFPSET
LKLSEKCI
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtccatccccggagtcaacgcgtccttctcctccactccggagaggttgaacagccca
gtgaccattcccgcagtgatgtttatcttcggggtggtgggcaacctggtggccatcgta
gtattgtgcaagtcgcgcaaggagcagaaggagactaccttttacactctggtatgtggg
ctggctgtcactgacctactgggcacattgttggtaagcccagtgaccatcgccacatac
atgaagggccagtggcccggagaccaggcattgtgtgactacagcaccttcatcctactt
ttcttcggcctgtcgggtctcagcatcatctgtgccatgagcattgagcgctacctggcc
atcaaccacgcctacttctacagccactacgtggacaagcggctggccggtctcacgctc
ttcgccgtctatgcatctaacgtgctcttctgcgcactgcccaacatgggcctgggtagg
tccgagcggcagtacccggggacctggtgcttcatcgactggaccaccaacgtaacggcc
tacgccgccttctcttacatgtacgcgggcttcagttccttcctcatcctcgccaccgtg
ctctgcaatgtgctggtgtgcggcgcgctgctccgcatgcaccgccagttcatgcgccgc
acctcgctgggcacggagcagcaccacgcggccgctgcagcagcggtggcttcggtggcc
tgtcggggtcacgcggccgcctccccagccctgcagcgcctcagtgactttcgccgccgc
aggagcttccggcgcatcgcgggtgcagagatccagatggtcatcttactcatcgccacc
tctctggtggtgctcatctgctccattccgctcgtggtgcgagtgttcatcaaccagtta
tatcagccaagtgtggtgaaagacatcagcagaaacccggatttgcaggccatcagaatt
gcttctgtgaaccccatcctggacccttggatctacatccttcttcggaagactgtgctc
agtaaagccatagaaaagatcaagtgcctcttctgccgcattggtggttctggcagagac
ggttcagcacagcactgctcagagagtcggaggacatcttctgccatgtctggccactcc
cgctccttcctctcgcgggagttgagggagatcagcagcacctctcagaccctcctatac
ctgccagacctaactgaaagcagcctcggaggcaagaatttgcttccaggtacgcatggc
atgggcctgacccaagcagacaccacctcgctgagaactttgcgaatttcagagacctca
gactcctcccagggccaggactctgagagtgtcttgttggtggatgaggttagtgggagc
cagagagaggagcctgcctctaaggggaactctctgcaagtcacgttccccagtgaaacg
ctgaaattatctgaaaaatgtatatag

DBGET integrated database retrieval system