KEGG   Rattus norvegicus (rat): 24931Help
Entry
24931             CDS       T01003                                 

Gene name
Cd8b, Cd8b1
Definition
(RefSeq) CD8b molecule
  KO
K06459  T-cell surface glycoprotein CD8 beta chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04660  T cell receptor signaling pathway
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    24931 (Cd8b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24931 (Cd8b)
   04612 Antigen processing and presentation
    24931 (Cd8b)
   04660 T cell receptor signaling pathway
    24931 (Cd8b)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    24931 (Cd8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    24931 (Cd8b)
CD molecules [BR:rno04090]
 Proteins
  24931 (Cd8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig I-set Herpes_gE Ig_2
Motif
Other DBs
NCBI-GeneID: 24931
NCBI-ProteinID: NP_113727
RGD: 2317
Ensembl: ENSRNOG00000007129
UniProt: P05541
Position
4q31
AA seq 208 aa AA seqDB search
MQPWLWLVFSVKLSALWGSSALLQTPSSLLVQTNQTAKMSCEAKTFPKGTTIYWLRELQD
SNKNKHFEFLASRTSTKGIKYGERVKKNMTLSFNSTLPFLKIMDVKPEDSGFYFCAMVGS
PMVVFGTGTKLTVVDVLPTTAPTKKTTLKKKQCPTPHPKTQKGLTCGLITLSLLVACILV
LLVSLSVAIHFHCMRRRARIHFMKQFHK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcagccatggctctggctggtcttcagtgtgaagctatcagctctctggggcagctct
gccctccttcagactccttcatccctgctggttcaaaccaaccaaacagcaaaaatgtcc
tgtgaggctaaaaccttccctaaaggaacaaccatctactggctgagagagctccaggat
tccaacaagaacaagcactttgagttcctggcgtcccggacttcaaccaaaggaattaaa
tatggtgaaagggtgaagaagaatatgactctgtctttcaattcaaccctgccctttctc
aagatcatggatgtgaagccagaggacagtggcttctacttctgcgcgatggttgggagt
cccatggtagtctttgggacagggacaaagctgactgtggttgatgtccttcctacaact
gctccaaccaaaaagactacactgaagaagaaacaatgtccaaccccccacccaaagacc
cagaaaggcttgacatgtggcctcattaccctcagcctgctggtggcctgcatcctggtt
ctgctggtatccctcagtgtggccatccactttcactgcatgcggaggagagcccggatt
cacttcatgaaacagtttcacaaatga

DBGET integrated database retrieval system