KEGG   Rattus norvegicus (rat): 24932Help
Entry
24932             CDS       T01003                                 

Gene name
Cd4, W3/25, p55
Definition
(RefSeq) Cd4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04514  Cell adhesion molecules (CAMs)
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05166  Human T-cell leukemia virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24932 (Cd4)
   04514 Cell adhesion molecules (CAMs)
    24932 (Cd4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24932 (Cd4)
   04612 Antigen processing and presentation
    24932 (Cd4)
   04660 T cell receptor signaling pathway
    24932 (Cd4)
   04658 Th1 and Th2 cell differentiation
    24932 (Cd4)
   04659 Th17 cell differentiation
    24932 (Cd4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24932 (Cd4)
  09163 Immune disease
   05340 Primary immunodeficiency
    24932 (Cd4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24932 (Cd4)
   05170 Human immunodeficiency virus 1 infection
    24932 (Cd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    24932 (Cd4)
CD molecules [BR:rno04090]
 Proteins
  24932 (Cd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD4-extracel C2-set ig Tcell_CD4_C V-set Ig_3 I-set Ig_2 Izumo-Ig
Motif
Other DBs
NCBI-GeneID: 24932
NCBI-ProteinID: NP_036837
RGD: 2306
Ensembl: ENSRNOG00000016294
UniProt: P05540
Structure
PDB: 

Position
4q42
AA seq 457 aa AA seqDB search
MCRGFSFRHLLPLLLLQLSKLLVVTQGKTVVLGKEGGSAELPCESTSRRSASFAWKSSDQ
KTILGYKNKLLIKGSLELYSRFDSRKNAWERGSFPLIINKLRMEDSQTYVCELENKKEEV
ELWVFRVTFNPGTRLLQGQSLTLILDSNPKVSDPPIECKHKSSNIVKDSKAFSTHSLRIQ
DSGIWNCTVTLNQKKHSFDMKLSVLGFASTSITAYKSEGESAEFSFPLNLGEESLQGELR
WKAEKAPSSQSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTL
TLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEARVSRQEKVIQV
QAPEAGVWQCLLSEGEEVKMDSKIQVLSKGLNQTMFLAVVLGSAFSFLVFTGLCILFCVR
CRHQQRQAARMSQIKRLLSEKKTCQCSHRMQKSHNLI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgaggcttctctttcaggcacttgctgccgctgctgctcctgcagctgtcaaaa
ctcctagttgtcacccaaggaaagaccgtggtgctggggaaggaagggggttcagcagaa
ctgccctgtgaaagtacctcgaggaggagtgcatccttcgcgtggaagtcctctgaccaa
aagacaattctgggatataagaacaagttattgattaaaggttcacttgagctgtatagt
cgttttgattccagaaaaaatgcatgggagagaggatcatttcccctcatcatcaataaa
cttaggatggaggactctcagacttatgtctgcgagctggagaacaagaaagaggaggtg
gagttgtgggtcttcagagtgaccttcaatccgggtaccagactgttgcaggggcagagc
ctgaccctgatcttggatagcaaccctaaggtctctgaccccccgatagagtgcaaacac
aaaagcagtaacattgtcaaggactccaaagctttctccacgcacagcctaaggattcag
gacagtggcatctggaactgcaccgtgaccctgaaccagaagaagcactcatttgacatg
aaactctcagtgctgggctttgcgagcacatccatcacggcctataagagtgagggggag
tcagcggagttctccttcccactcaaccttggagaggaaagcctgcagggagagttgaga
tggaaggcagagaaggctccttcttcccagtcctggatcaccttctccctaaagaaccaa
aaggtgtctgtgcagaagtctactagcaaccccaagttccagctgtccgaaacgctccca
ctcacccttcagataccccaggtctcccttcagtttgctggttctggcaacctgaccctg
actctggacagagggatactgtatcaggaagtgaacctggtggtgatgaaagtgactcag
cccgacagcaacactttgacctgtgaggtgatgggacccacctcacccaagatgagactg
atcttgaagcaggagaatcaggaggccagggtctccaggcaggagaaagtgattcaagtg
caggcccctgaagcaggggtgtggcaatgtctactgagtgaaggtgaagaggtcaagatg
gactccaagatccaggttttatccaaagggttgaaccagacaatgttcctggctgtcgtg
ctggggagcgccttcagctttctggttttcacggggctctgcatcctattctgtgtcagg
tgccggcaccaacagcgccaggcagcacggatgtctcagatcaagaggcttctcagtgag
aagaagacttgccagtgctcccaccggatgcagaaaagccacaatctcatatga

DBGET integrated database retrieval system