KEGG   Rattus norvegicus (rat): 24936
Entry
24936             CDS       T01003                                 

Gene name
Cd9
Definition
(RefSeq) CD9 molecule
  KO
K06460  CD9 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24936 (Cd9)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24936 (Cd9)
CD molecules [BR:rno04090]
 Proteins
  24936 (Cd9)
SSDB
Motif
Pfam: Tetraspanin CD20 DUF5321 IBV_3C
Other DBs
NCBI-GeneID: 24936
NCBI-ProteinID: NP_444177
RGD: 2318
Ensembl: ENSRNOG00000019556
UniProt: P40241 B1WBM0
Position
4q42
AA seq 226 aa
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYI
LIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQ
EFYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVEQFISDICPKKQVLESFQVKSCP
DAIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
NT seq 681 nt   +upstreamnt  +downstreamnt
atgccggtcaaaggaggtagcaagtgcatcaaatacctgctctttggatttaacttcatc
ttctggctcgccggcatcgcagtgcttgccattggactatggctgcggttcgactctcag
accaagagcatcttcgagcaagaaactaatcattccagcttctacacaggagtgtacatt
ctgattggagctggggccctcatgatgctagttggtttcctgggctgctgtggagctgta
caagagtcacagtgcatgctgggattgttcttcggattcctcttggtgatattcgccatt
gagatcgccgcagccgtctggggctatacccacaaggacgaggtgattaaagaactccag
gagttttacaaggacacctaccaaaagttaaggaacaaggatgagccccagcgggaaaca
ctcaaagccatccatatggcgttgaactgctgtggcatagctggtggtgtggagcagttt
atctcggacatctgccccaaaaagcaggttctggaatccttccaggttaagtcctgcccg
gatgccatcgatgaggtcttccacagcaagttccacatcattggagcagtgggcatcggt
atcgccgtggtgatgatcttcggtatgattttcagcatgattctgtgctgcgccatccgc
aggagccgagaaatggtctag

DBGET integrated database retrieval system