KEGG   Rattus norvegicus (rat): 24938Help
Entry
24938             CDS       T01003                                 

Gene name
Grpr
Definition
(RefSeq) gastrin releasing peptide receptor
  KO
K04169  gastrin-releasing peptide receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24938 (Grpr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24938 (Grpr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24938 (Grpr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Bombesin
    24938 (Grpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 24938
NCBI-ProteinID: NP_036838
RGD: 2750
Ensembl: ENSRNOG00000004124
UniProt: P52500
Position
Xq14
AA seq 384 aa AA seqDB search
MDPNNCSHLNLEVDPFLSCNNTFNQTLSPPKMDNWFHPGIIYVIPAVYGLIIVIGLIGNI
TLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFI
QLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFS
DLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYIIPLSIISVYYYFIARNLIQ
SAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSML
HFITSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPSLLNRSHSTGRSTTCMT
SFKSTNPSATFSLINGNICHEGYV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatccaaataattgttcccacctgaacttggaagtggatcctttcctgtcctgcaac
aacaccttcaatcaaactctgagtccccccaagatggacaactggtttcacccgggaatc
atctatgtcattcctgcagtttatgggcttatcatcgtgataggcctcattggcaacatc
accctgatcaagatcttctgtacggtcaagtccatgcgaaacgtgccaaacctgttcatc
tctagcctggcattgggagacctactgctgctggttacatgcgcccctgtggatgccagc
aagtacctggctgacaggtggctatttggcaggattggctgcaaactgatcccctttata
caacttacttcagtgggggtgtctgtcttcacacttacggcactgtcagctgacaggtac
aaagccatcgtcaggccaatggatatccaggcatcccatgccctgatgaagatctgtctc
aaagctgccttaatctggatcgtctctatgctgttggccatcccagaggctgtattttcg
gaccttcacccctttcatgtgaaagataccaaccaaaccttcattagttgtgccccctac
ccacactccaatgagctgcaccctaaaatccattccatggcttcctttctggtcttttac
attatcccactgtcgatcatctctgtctactactacttcattgcccgaaatctgattcag
agtgcctacaatcttcctgtggaaggaaatatacatgtcaagaagcagatcgaatcccgg
aagcggcttgccaagacagtactggtgtttgtgggcctcttcgccttctgctggctcccc
aatcatgtcatctacctgtaccgttcctaccactactctgaggtggacacctccatgctc
cactttatcaccagcatctgtgcccgcctcctggccttcaccaactcctgtgtgaacccc
tttgccctgtatctgctgagcaagagcttcaggaagcagttcaacactcaacttctctgc
tgccagcccagcctgttgaacaggtctcacagcacaggcagaagtaccacctgcatgacc
tccttcaagagcaccaacccctcagctaccttcagcctcatcaacggaaatatctgccat
gaggggtatgtctag

DBGET integrated database retrieval system