KEGG   Rattus norvegicus (rat): 24944
Entry
24944             CDS       T01003                                 

Gene name
Lamp2
Definition
(RefSeq) lysosomal-associated membrane protein 2
  KO
K06528  lysosomal-associated membrane protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04145  Phagosome
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24944 (Lamp2)
   04142 Lysosome
    24944 (Lamp2)
   04140 Autophagy - animal
    24944 (Lamp2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24944 (Lamp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24944 (Lamp2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24944 (Lamp2)
   04090 CD molecules [BR:rno04090]
    24944 (Lamp2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Cargo receptors
    24944 (Lamp2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24944 (Lamp2)
CD molecules [BR:rno04090]
 Proteins
  24944 (Lamp2)
SSDB
Motif
Pfam: Lamp ATP-synt_S1
Other DBs
NCBI-GeneID: 24944
NCBI-ProteinID: NP_058764
RGD: 2990
Ensembl: ENSRNOG00000000164
UniProt: P17046
Position
Xq35
AA seq 411 aa
MRLLSPVTGSKLVLLFLFLGAVRSDALKLNLTDSKGTCLYAEWEMNFTITYEALKVNETV
TITVPDKVTYNGSSCGDDKNGAKIMIQYGSTLSWAVNFTKEASQYFINNITLSYNTNDTK
TFPGAVPKGILTVIIPVGSQLPLGVIFKCSSVLTFNLSPVVQHYWGIHLQAFVQNGTVSK
HEQVCKEDKTATTVAPIIHTTVPSPTTTLTPTSIPVPTPTVGNYTISNGNATCLLATMGL
QLNITEEKVPFIFNINPATTNFTGSCQPQTAQLRLNNSQIKYLDFIFAVKNEKRFYLKEV
NVNMYLANGSAFHVSNNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTK
GEYSTAQDCSADEDNFLVPIAVGAALGGVLILVLLAYFIGLKRHHTGYEQF
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcgcctcctctctccggttacgggctcgaagctcgtcctgctctttctgttcctggga
gcagttcggtccgatgcattgaaacttaatttgacagattcaaagggtacttgcctttat
gcagaatgggagatgaatttcacaataacatatgaagctctaaaagtcaatgaaactgta
accattacagtgcctgacaaggtgacatacaatggaagcagttgtggcgatgataagaat
ggtgccaaaataatgatacaatatggatccactctctcttgggctgtgaatttcaccaag
gaagcatctcagtattttattaacaacatcacgctttcttacaacactaatgataccaaa
acatttcctggtgctgtacctaaaggaatccttactgttatcattcctgtgggatcccag
cttccattgggtgtcatctttaagtgcagtagtgttttaactttcaacctgagtcctgtt
gttcagcactattggggcattcacctgcaagcttttgtccaaaatggtacagtgagtaaa
catgaacaagtgtgtaaggaggacaaaactgctaccactgtagcacccatcattcacacc
accgtgccatcgcctactacgacactcactccaacttcaatacccgttccaactccaacg
gttggaaactacaccatttctaatggcaatgctacctgtctgctggctaccatggggctg
cagctgaacatcaccgaggagaaggtgcctttcatttttaacatcaaccctgccacaacc
aacttcaccggcagctgtcagccccaaacagctcaacttaggctgaacaacagccaaatt
aagtatctcgactttatctttgctgtgaaaaatgaaaaacggttctatctgaaggaagtg
aatgtcaacatgtatttggctaatggctcagctttccatgtttcaaataacaaccttagc
ttctgggatgctcctctgggaagttcttatatgtgcaacaaagagcaggtggtttccgtg
tctcgaacatttcagataaatacctttaacctgaaggtgcaaccttttaatgtgacgaaa
ggagagtattctacagctcaagactgcagtgcagatgaagacaacttccttgtgcccata
gcggtgggagcagccctgggaggagtacttattctagtgttgctggcttattttattggt
ctcaagcgccatcatactggatatgagcaattttag

DBGET integrated database retrieval system