KEGG   Rattus norvegicus (rat): 24944
Entry
24944             CDS       T01003                                 

Gene name
Lamp2
Definition
(RefSeq) lysosome-associated membrane glycoprotein 2 precursor
  KO
K06528  lysosomal-associated membrane protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04145  Phagosome
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24944 (Lamp2)
   04142 Lysosome
    24944 (Lamp2)
   04140 Autophagy - animal
    24944 (Lamp2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24944 (Lamp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24944 (Lamp2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24944 (Lamp2)
   04090 CD molecules [BR:rno04090]
    24944 (Lamp2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Cargo receptors
    24944 (Lamp2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24944 (Lamp2)
CD molecules [BR:rno04090]
 Proteins
  24944 (Lamp2)
SSDB
Motif
Pfam: Lamp ATP-synt_S1
Other DBs
NCBI-GeneID: 24944
NCBI-ProteinID: NP_058764
RGD: 2990
Ensembl: ENSRNOG00000000164
UniProt: P17046
Position
X
AA seq 411 aa
MRLLSPVTGSKLVLLFLFLGAVRSDALKLNLTDSKGTCLYAEWEMNFTITYEALKVNETV
TITVPDKVTYNGSSCGDDKNGAKIMIQYGSTLSWAVNFTKEASQYFINNITLSYNTNDTK
TFPGAVPKGILTVIIPVGSQLPLGVIFKCSSVLTFNLSPVVQHYWGIHLQAFVQNGTVSK
HEQVCKEDKTATTVAPIIHTTVPSPTTTLTPTSIPVPTPTVGNYTISNGNATCLLATMGL
QLNITEEKVPFIFNINPAITNFTGSCQPQTAQLRLNNSQIKYLDFIFAVKNEKRFYLKEV
NVNMYLANGSAFHVSNNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTK
GEYSTAQDCSADEDNFLVPIAVGAALGGVLILVLLAYFIGLKRHHTGYEQF
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcgcctcctctctccggttacgggctcgaagctcgtcctgctctttctgttcctggga
gcagttcggtccgatgcattgaaacttaatttgacagattcaaagggtacttgcctttat
gcagaatgggagatgaatttcacaataacatatgaagctctaaaagtcaatgaaactgta
accattacagtgcctgacaaggtgacatacaatggaagcagttgtggcgatgataagaat
ggtgccaaaataatgatacaatatggatccactctctcttgggctgtgaatttcaccaag
gaagcatctcagtattttattaacaacatcacgctttcttacaacactaatgataccaaa
acatttcctggtgctgtacctaaaggaatccttactgttatcattcctgtgggatcccag
cttccattgggtgtcatctttaagtgcagtagtgttttaactttcaacctgagtcctgtt
gttcagcactattggggcattcacctgcaagcttttgtccaaaatggtacagtgagtaaa
catgaacaagtgtgtaaggaggacaaaactgctaccactgtagcacccatcattcacacc
accgtgccatcgcctactacgacactcactccaacttcaatacccgttccaactccaacg
gttggaaactacaccatttctaatggcaatgctacctgtctgctggctaccatggggctg
cagctgaacatcaccgaggagaaggtgcctttcatttttaacatcaaccctgccataacc
aacttcaccggcagctgtcagccccaaacagctcaacttaggctgaacaacagccaaatt
aagtatctcgactttatctttgctgtgaaaaatgaaaaacggttctatctgaaggaagtg
aatgtcaacatgtatttggctaatggctcagctttccatgtttcaaataacaaccttagc
ttctgggatgctcctctgggaagttcttatatgtgcaacaaagagcaggtggtttccgtg
tctcgaacatttcagataaatacctttaacctgaaggtgcaaccttttaatgtgacgaaa
ggagagtattctacagctcaagactgcagtgcagatgaagacaacttccttgtgcccata
gcggtgggagcagccctgggaggagtacttattctagtgttgctggcttattttattggt
ctcaagcgccatcatactggatatgagcaattttag

KEGG   Rattus norvegicus (rat): 25328
Entry
25328             CDS       T01003                                 

Gene name
Lamp1
Definition
(RefSeq) lysosome-associated membrane glycoprotein 1 precursor
  KO
K06528  lysosomal-associated membrane protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04145  Phagosome
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    25328 (Lamp1)
   04142 Lysosome
    25328 (Lamp1)
   04140 Autophagy - animal
    25328 (Lamp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25328 (Lamp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25328 (Lamp1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25328 (Lamp1)
   04090 CD molecules [BR:rno04090]
    25328 (Lamp1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Cargo receptors
    25328 (Lamp1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   25328 (Lamp1)
CD molecules [BR:rno04090]
 Proteins
  25328 (Lamp1)
SSDB
Motif
Pfam: Lamp ATP-synt_S1 CTV_P6
Other DBs
NCBI-GeneID: 25328
NCBI-ProteinID: NP_036989
RGD: 2989
Ensembl: ENSRNOG00000019629
Vega: OTTRNOG00000002006
UniProt: P14562
Position
16
AA seq 407 aa
MAAPGARRPLLLLLLAGLAHSAPALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNM
TLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDT
QFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFS
KEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKD
NTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTL
PDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFG
SVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggcggccccgggcgcccggcggccgctgctcctgttgctgctggcaggccttgcacac
agcgccccagcactgttcgaggtgaaagacaacaacggcacagcgtgtataatggccagc
ttctctgcctcctttctgaccacctatgatgctggacatgtttctaaggtctcgaatatg
accctgccagcctctgcagaagtcctgaagaatagcagctcttgtggtgaaaagaatgct
tctgagcccaccctcgcaatcacctttggagaaggatatttactgaaactcaccttcaca
aaaaacacaacacgttacagtgtccagcacatgtatttcacatataacctgtcagacaca
caattctttcccaatgccagctccaaagggcccgacactgtggattccacaactgacatc
aaggcagacatcaacaaaacataccgatgtgtcagcgacatcagggtctacatgaagaat
gtgaccattgtgctctgggacgctactatccaggcctacctgccgagtagcaacttcagc
aaggaagagacacgctgcccacaggatcaaccttccccaactactgggccacccagcccc
tcaccaccacttgtgcccacaaaccccagtgtgtccaagtacaatgtgactggtgacaat
ggaacctgcctgctggcctctatggcactgcaactcaacatcacctacatgaagaaggac
aacacgactgtgaccagagcattcaacatcaacccaagtgacaaatatagtgggacttgc
ggtgcccagttggtgaccctgaaggtggggaacaagagcagagtcctggagctgcagttt
gggatgaatgccacttctagcctgtttttcctgcaaggagttcagttgaacatgactctt
cctgatgccatagagcccacgttcagcacctccaactattccctgaaagctcttcaggcc
agtgtcggcaactcatacaagtgcaacagtgaggagcacatctttgtcagcaaggcgctc
gccctcaatgtcttcagcgtgcaagtccaggctttcagggtagaaagtgacaggtttggg
tctgtggaagagtgtgtacaggacggtaacaacatgctgatccccattgctgtgggcggg
gccctggcagggctggtcctcatcgtcctcatcgcctacctcatcggcaggaagaggagt
cacgcgggctatcagaccatctag

KEGG   Rattus norvegicus (rat): 287435
Entry
287435            CDS       T01003                                 

Gene name
Cd68
Definition
(RefSeq) macrosialin precursor
  KO
K06501  CD68 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    287435 (Cd68)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    287435 (Cd68)
CD molecules [BR:rno04090]
 Proteins
  287435 (Cd68)
SSDB
Motif
Pfam: Lamp ATP-synt_S1
Other DBs
NCBI-GeneID: 287435
NCBI-ProteinID: NP_001026808
RGD: 1305970
Ensembl: ENSRNOG00000037563
UniProt: Q4FZY1
Position
10
AA seq 330 aa
MRFPVCLTLLVLLVAQGTGKDCPHKKAATLLPSFTETPTTTGSTASPTTTHRPTTTSHRP
TTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHGNATVSPTTNSPGFSTVGPHPGPPPPS
PSPSPSSTGALGNYTWTNGSQPCVQLQAQIQIRILYLTQGGKKAWGLSVLNPNKTKVQGG
CDSAHPHLALSFPYGQLTFGFKQDRHQSHSTVYLNYMAVEYNVSFPQAAQWTFSAQNSSL
QELQAPLGQSFCCGNTSIVLSPAIHLDLLSLRLQAAQLPDKGHFGPCFSCASDQSLLLPL
IIGLVLLGLLTLVLIAFCVTRRRQSTYQPL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggttccctgtgtgtctgaccttgctggtactgcttgtagcccaaggaacagggaaa
gactgtcctcacaaaaaggctgccactcttctgccatccttcacggagacacctacaacc
accggaagcacagcaagccctacgaccacccacaggcccaccacaaccagccacaggccc
accacaaccagccacaggcccaccaccaccagccacaggcccaccaccaccagccacagg
cccaccaccaccagccacaggcccaccaccaccagtcatgggaatgccacagtttctccc
accacaaacagtccaggcttctccactgttggccctcaccctggaccacctccgccctca
ccaagtcctagtccaagctctactggggctcttggaaactacacatggactaatggttcc
cagccatgtgttcagctccaagcccaaattcaaattcgcatcttgtacctgacccagggt
ggaaaaaaggcctggggcctctctgtattgaacccgaacaaaaccaaggtccaggggggc
tgtgacagtgcccatccccacttggctctctcattcccttacggacagcttacctttgga
ttcaaacaggaccgacatcagagccacagtacagtctaccttaactacatggcagtggaa
tacaatgtgtccttcccacaagcagcacagtggacattctcagcgcagaattcatctctt
caagagctccaagctcccctgggccaaagcttctgttgcggaaatacaagcatagttctt
tctccagcaattcacctggacctgctctccctgaggctgcaggctgctcagttgccggac
aagggacacttcgggccatgcttctcttgcgccagtgaccaatctctcttgctgcctctc
atcattggcctggtcctcctgggcctcctcaccctggtgctcattgccttctgcgttacc
cggagacgacaatcaacctaccagcccctctga

KEGG   Rattus norvegicus (rat): 303801
Entry
303801            CDS       T01003                                 

Gene name
Lamp3
Definition
(RefSeq) lysosome-associated membrane glycoprotein 3 precursor
  KO
K06562  lysosomal-associated membrane protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    303801 (Lamp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    303801 (Lamp3)
CD molecules [BR:rno04090]
 Proteins
  303801 (Lamp3)
SSDB
Motif
Pfam: Lamp ATP-synt_S1 MWFE
Other DBs
NCBI-GeneID: 303801
NCBI-ProteinID: NP_001012015
RGD: 1307928
Ensembl: ENSRNOG00000022792
UniProt: Q5XI99
Position
11
AA seq 408 aa
MPGQTSAVAVLLCLAVILHGYQIREKEFPEARGYLQYTATTTEQITAKPPLPLTNQTSHA
TLASRSKDDYIQTAAETSTFEDTAHITMKTAIPVTTKSLLPISSTSYTFVRTNNSHMTAS
STEDTIGSGSITHLPFPTTRASLAAVNHITGRSTQLGGQTTLPKALFTPSHESTTTQRPT
LSTIVSELTPTGKDRSTTSSVPLVPRPTFVTWSSPAKIGTYEVLNGSRLCIKAEMGIALI
VQEKGLDSATQRHFNIDPSLTHASGKCGSQNSNLFLNFQGGSVNVTFTKEENLYYVSEVG
AYLTISNTEKTYQGKSTMMMFETVVGHSFKCVSEQSIQLSAQLQMKTMNIHLQAFDFEGD
SFGIVDECLSDYTVVLPVVGIIVVVLCVVGLGIYKIRQRRQSSAYQRI
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcctgggcagacctctgcagtagctgtactcctgtgtctggctgtaattttacatggc
tatcaaataagagaaaaagaatttccagaagccagaggctatcttcaatatactgcaaca
acaacagaacagatcacagcaaaacctccactaccactgactaaccaaacatctcatgca
actttagcatcaaggtccaaggatgattacattcaaacggctgccgaaacttccactttt
gaagacacagcccacataacaatgaaaacagcaatcccagtaactacgaagagccttcta
cccatcagctcaactagctatacctttgttagaactaataactcacacatgactgcttca
tctactgaagatactattggctctggctcaattacacatttaccatttcctacaaccaga
gctagtctagctgctgtcaatcatataactgggagaagtacccaacttggtggtcagact
acccttcccaaagcacttttcacaccatcacacgaaagcacaaccactcagaggccaact
ctatccactattgtctcagaactaacacctacaggcaaggacagatcaacaacttcatct
gttcccttagttcccaggcctacttttgtaacttggtcatcacctgccaagattggaact
tatgaagtactaaatggaagcaggctctgtataaaagcagagatgggaatagcgctgatt
gttcaagaaaagggtttggattctgcaacccagaggcacttcaacattgaccccagtcta
acccatgcatctgggaaatgtggctcccaaaactccaacctcttcttgaatttccagggt
ggatccgtgaatgtcacatttaccaaggaagaaaacttatattacgttagtgaagttgga
gcttatttgaccatctcaaatacagagaagacctaccaaggaaagagtactatgatgatg
tttgagacagtagttgggcattctttcaagtgtgtcagtgagcagagcatccagctatca
gctcagcttcaaatgaaaacaatgaatatccatcttcaggcctttgattttgaaggagac
tcctttggaattgtggacgagtgtttgtcagactacacagttgtgcttcctgtggttggg
atcatcgtggttgtcctctgtgttgtgggtctgggcatctacaaaatccgccaaaggcgt
cagtcatctgcataccagagaatctaa

DBGET integrated database retrieval system