KEGG   Rattus norvegicus (rat): 24948Help
Entry
24948             CDS       T01003                                 

Gene name
Fmr1, FMRP
Definition
(RefSeq) fragile X mental retardation 1
  KO
K15516  fragile X mental retardation protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    24948 (Fmr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    24948 (Fmr1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     24948 (Fmr1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     24948 (Fmr1)
   mRNA cycle factors
    Stress granule specific factors
     24948 (Fmr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_9 FXMRP1_C_core Tudor_FRX1 FXMR_C2 KH_1 Agenet KH_2
Motif
Other DBs
NCBI-GeneID: 24948
NCBI-ProteinID: NP_434691
RGD: 2623
Ensembl: ENSRNOG00000057464
UniProt: Q80WE1
Position
Xq37
AA seq 581 aa AA seqDB search
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPPVGYNKDIN
ESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKP
ATKDTFHKIKLEVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKR
AHMLIDMHFRSLRTKLSLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGAN
IQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKN
GKLIQEIVDKSGVVRVRIEAENEKSVPQEEENLPPSSLPSNNSRVGSNSSEEKKHLDTKE
NTHFSQPNSTKVQRGMVPFVFVGTKDSIANATVLLDYHLNYLKEVDQLRLERLQIDEQLR
QIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRGHGRRGPGYTSESDHRDELSDWS
LAPTEEERESFLRRGDGRRRGGGGRGQGGRGRGGGFKGNDDHSRTDNRPRNPRETKGRTT
DGSLQSTSSEGSRLRTGKDRNQKKEKPDSVDGLQPLVNGVP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctggtggtggaagtgcggggctccaatggcgctttctacaaggcatttgta
aaagatgtccatgaagattctataacagttgcttttgaaaacaactggcagccagagaga
cagattcctttccatgatgtgagattcccaccacctgtaggttataataaagatataaac
gaaagtgatgaagttgaggtttattccagagcaaatgaaaaagagccttgctgttggtgg
ttagctaaagtgaggatgataaagggtgagttttatgtgatagaatatgcagcatgtgat
gctacatacaatgaaattgtcacaattgagcgtctacgatctgttaatcccaacaaacct
gctacaaaagatactttccataagatcaagctggaagtgccagaagatttacgacaaatg
tgtgccaaagaatcggcacataaggattttaaaaaggcagttggtgccttctctgtaact
tatgatccagaaaattatcagctggtaattttgtccatcaatgaagtcacctcaaagcga
gcccacatgttaattgacatgcactttcgaagtctgcgcaccaagttgtctcttatactg
agaaatgaagaagccagtaaacaactggagagttcaaggcagcttgcctcaagatttcat
gaacagtttatcgtacgagaagatctgatgggtctagctattggtactcatggtgctaat
attcagcaagctagaaaagtacctggggtcactgctattgatttagatgaggatacctgc
acatttcatatttatggagaggatcaagatgcagtcaaaaaggctagaagctttctggaa
tttgctgaagatgtcatacaagttccacgaaatttagtaggcaaagtaataggaaaaaat
ggaaaactgattcaagagattgtggacaagtcaggagttgtgagggtgaggatcgaagct
gaaaatgagaaaagtgtcccacaagaagaggaaaatttgccaccaagttccctaccttcc
aataattcaagggttggatctaattcctctgaagaaaagaaacatttagatacaaaggaa
aacacccatttttctcaacctaacagtacaaaagtccagagggggatggtaccatttgtt
tttgtgggaacaaaagacagcatcgctaatgccactgttcttttggattatcacctgaac
tacttaaaggaagtagaccagttgcgtttggagagattacaaattgatgagcagttgcga
caaattggagctagttctagaccaccaccaaatcgtacagataaggaaaaaggctatgtg
actgatgatggtcaaggaatgggtcgaggtagtagaccttacagaaatagggggcacggc
agacgcggtcctggatatacttcagaatctgaccacagagacgaactcagtgattggtca
ttagctccaacagaggaagagagggagagcttcctgcgcagaggagacggacggcggcgt
ggaggaggcggaagaggacaaggaggaagaggaagaggaggaggtttcaaaggaaatgac
gatcattcccgaacagataatcgtccacgtaatccaagagagactaaaggaagaacaact
gatggatccctgcagagcacctccagtgaagggagccggctgcgcaccgggaaagatcgg
aaccagaagaaggaaaagccagacagcgtggatgggctgcaaccactcgtgaatggagta
ccctaa

DBGET integrated database retrieval system