KEGG   Rattus norvegicus (rat): 24952
Entry
24952             CDS       T01003                                 

Gene name
Gcg
Definition
(RefSeq) pro-glucagon preproprotein
  KO
K05259  glucagon
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04714  Thermogenesis
rno04911  Insulin secretion
rno04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24952 (Gcg)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24952 (Gcg)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24952 (Gcg)
   04922 Glucagon signaling pathway
    24952 (Gcg)
  09159 Environmental adaptation
   04714 Thermogenesis
    24952 (Gcg)
SSDB
Motif
Pfam: Hormone_2 Lipoprotein_10 MPM1 DUF2370
Other DBs
NCBI-GeneID: 24952
NCBI-ProteinID: NP_036839
RGD: 2668
Ensembl: ENSRNOG00000005498
UniProt: G3V6P5
Position
3
AA seq 180 aa
MKTVYIVAGLFVMLVQGSWQHAPQDTEENARSFPASQTEPLEDPNQINEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMNTILDNLATRDFINWLIQTKITDKK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaagaccgtttacatcgtggctggattgtttgtaatgctggtacaaggcagctggcag
catgcccctcaagacacggaggagaacgccagatcattcccagcttcccagacagaacca
cttgaagaccctaatcagataaacgaagacaaacgccattcacagggcacattcaccagt
gactacagcaaatacctggactcccgccgtgctcaagattttgtgcagtggttgatgaac
accaagaggaaccggaacaacattgccaaacgtcatgatgaatttgagaggcatgctgaa
gggacctttaccagtgatgtgagttcttacttggagggccaggcagcaaaggaattcatt
gcttggctggtgaaaggccgaggaaggcgagacttcccggaagaagtcgccatagctgag
gaacttgggcgcagacatgctgatggatccttctctgatgagatgaacacgattctcgat
aaccttgccaccagagacttcatcaactggctgattcaaaccaagatcactgacaagaaa
tag

DBGET integrated database retrieval system