KEGG   Rattus norvegicus (rat): 24953Help
Entry
24953             CDS       T01003                                 

Gene name
Gcgr
Definition
(RefSeq) glucagon receptor
  KO
K04583  glucagon receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24953 (Gcgr)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24953 (Gcgr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24953 (Gcgr)
G protein-coupled receptors [BR:rno04030]
 Class B. Secretin receptor family
  Pancreatic peptide
   Glucagon
    24953 (Gcgr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM VSP Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 24953
NCBI-ProteinID: NP_742088
RGD: 2669
Ensembl: ENSRNOG00000036692
UniProt: P30082 Q66HT0
Position
10q32.3
AA seq 485 aa AA seqDB search
MLLTQLHCPYLLLLLVVLSCLPKAPSAQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCN
RTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQSWRDAS
QCQMDDDEIEVQKGVAKMYSSYQVMYTVGYSLSLGALLLALVILLGLRKLHCTRNYIHGN
LFASFVLKAGSVLVIDWLLKTRYSQKIGDDLSVSVWLSDGAVAGCRVATVIMQYGIIANY
CWLLVEGVYLYSLLSITTFSEKSFFSLYLCIGWGSPLLFVIPWVVVKCLFENVQCWTSND
NMGFWWILRIPVLLAILINFFIFVRIIHLLVAKLRAHQMHYADYKFRLARSTLTLIPLLG
VHEVVFAFVTDEHAQGTLRSTKLFFDLFFSSFQGLLVAVLYCFLNKEVQAELLRRWRRWQ
EGKALQEERMASSHGSHMAPAGTCHGDPCEKLQLMSAGSSSGTGCEPSAKTSLASSLPRL
ADSPT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcacccagctccactgtccctacctgctgctgctgctggtggtgctgtcatgt
ctgccaaaggcaccctctgcccaggtaatggactttttgtttgagaagtggaagctctat
agtgaccagtgccaccacaacctaagcctgctgcccccacctactgagctggtctgcaac
agaactttcgacaagtactcctgctggcctgacacccctcccaacaccactgccaacatt
tcctgcccctggtacctaccttggtaccacaaagtgcagcaccgcctagtgttcaagagg
tgtgggcctgatgggcagtgggttcgagggccacgggggcagtcatggcgcgacgcctcc
caatgtcagatggatgatgacgagatcgaggtccagaagggggtagccaagatgtatagc
agctaccaggtgatgtacactgtgggctacagtctgtccctgggggccttgctcctggcg
ctggtcatcctgctgggcctcaggaagctgcactgcacccggaactacatccacgggaac
ctgttcgcgtccttcgtgctcaaggctggctctgtgctggtcattgattggctgctcaag
acacgctatagccagaagattggagatgacctcagtgtgagcgtctggctcagtgatggg
gcggtggctggctgcagagtggccacagtgatcatgcagtacggcatcatagccaactac
tgctggttgctggtggagggtgtgtacctgtacagcctgctgagcatcaccaccttctcg
gagaagagcttcttctccctctatctgtgcatcggctggggatctcccctgctgtttgtc
atcccctgggtggtggtcaagtgtctgtttgagaatgtccagtgctggaccagcaatgac
aatatgggattctggtggatcctgcgtatccctgtactcctggccatactgatcaatttt
ttcatctttgtccgcatcattcatcttcttgtggccaagctgcgtgcccatcagatgcac
tatgctgattacaagttccggctagccaggtccacgctgaccctcattcctctgctggga
gtccacgaagtggtctttgcctttgtgactgatgagcatgcccagggcaccctgcgctcc
accaagctcttttttgacctgttcttcagctccttccagggtctgctggtggctgttctc
tactgtttcctcaacaaggaggtgcaggcagagctactgcggcgttggaggcgatggcaa
gaaggcaaagctcttcaggaggaaaggatggccagcagccatggcagccacatggcccca
gcagggacttgtcatggtgatccctgtgagaaacttcagcttatgagtgcaggcagcagc
agtgggactggctgtgagccctctgcgaagacctcattggccagtagtctcccaaggctg
gctgacagccccacctga

DBGET integrated database retrieval system