KEGG   Rattus norvegicus (rat): 24957Help
Entry
24957             CDS       T01003                                 

Gene name
Glul, Glns
Definition
(RefSeq) glutamate-ammonia ligase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00250  Alanine, aspartate and glutamate metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
rno04217  Necroptosis
rno04724  Glutamatergic synapse
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    24957 (Glul)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    24957 (Glul)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    24957 (Glul)
   00220 Arginine biosynthesis
    24957 (Glul)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24957 (Glul)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24957 (Glul)
   04727 GABAergic synapse
    24957 (Glul)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24957 (Glul)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     24957 (Glul)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24957 (Glul)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-GeneID: 24957
NCBI-ProteinID: NP_058769
RGD: 2710
Ensembl: ENSRNOG00000049560
UniProt: P09606
Position
13q21
AA seq 373 aa AA seqDB search
MATSASSHLNKGIKQMYMNLPQGEKIQLMYIWVDGTGEGLRCKTRTLDCDPKCVEELPEW
NFDGSSTFQSEGSNSDMYLHPVAMFRDPFRRDPNKLVFCEVFKYNRKPAETNLRHSCKRI
MDMVSSQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLRCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRSASIRIPRIVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCL
LNETGDEPFQYKN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcagcaagttcccacttgaacaaaggcatcaagcagatgtacatgaacctg
ccccagggcgagaagatccaactcatgtatatctgggttgatggtaccggggaagggcta
cgctgcaagacccgtactctggactgtgaccccaagtgtgtagaagagttacccgagtgg
aactttgatggttctagtacgtttcagtctgaaggctccaacagcgacatgtacctccat
cctgtggccatgtttcgagaccccttccgcagagaccccaacaagctggtgttctgcgaa
gtattcaagtataaccggaagcccgcagagaccaacctgaggcacagctgtaagcgtata
atggacatggtgagcagccagcacccctggtttggaatggaacaggagtatactctcatg
ggaacagacggccaccctttcggctggccttctaatggcttccctggaccccaaggaccc
tattactgcggtgtgggagctgacaaggcttatggccgagatatcgtggaggctcactac
cgggcctgcttgtatgctggaatcaagatcacagggacaaatgccgaggttatgcctgcc
cagtgggaattccagataggaccctgcgaagggatccgcatgggagatcatctctgggta
gcccgttttatcttgcatcgggtatgcgaagactttggggtgatagcaacctttgacccc
aagcccattccagggaactggaatggggcaggctgccacaccaactttagcaccaaggcc
atgcgggaggagaatggtctgaggtgcattgaggaggccattgataaactgagcaagagg
caccagtaccacatccgtgcctacgaccccaaggggggcctggacaacgcccgccgtctg
actggattccacgaaacctccaacatcaacgacttttccgctggcgttgccaaccgcagc
gccagtatccgcattccccggattgtcggccaggagaagaagggttactttgaagaccgt
cggccttctgccaattgcgacccctatgcggtgacggaagccatcgtccgcacgtgtctc
ctcaacgaaactggcgacgagcccttccaatacaagaactaa

DBGET integrated database retrieval system