KEGG   Rattus norvegicus (rat): 24962Help
Entry
24962             CDS       T01003                                 

Gene name
Cth, H
Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00270  Cysteine and methionine metabolism
rno00450  Selenocompound metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
Module
rno_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    24962 (Cth)
   00270 Cysteine and methionine metabolism
    24962 (Cth)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    24962 (Cth)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24962 (Cth)
Enzymes [BR:rno01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     24962 (Cth)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24962 (Cth)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 GDC-P
Motif
Other DBs
NCBI-GeneID: 24962
NCBI-ProteinID: NP_058770
RGD: 2443
Ensembl: ENSRNOG00000010658
UniProt: P18757
Position
2q45
AA seq 398 aa AA seqDB search
MQKDASSSGFLPSFQHFATQAIHVGPEPEQWSSRAVVLPISLATTFKQDSPGQSSGFVYS
RSGNPTRNCLEKAVAALDGAKHCLTFARGLAATTTITHLLKAGDEVICMDEVYGGTNRYF
RRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIKACAQIVHKHKD
IILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVTSDDLNERLRFLQN
SLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNPRVEKVIYPGLPSHPQHE
LAKRQCTGCPGMVSFYIKGTLQHAQVFLKNIKLFALAESLGGYESLAELPAIMTHASVPE
KDRATLGISDTLIRLSVGLEDEKDLLEDLGQALKAAHP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggacgcctcctccagcggcttcctgcccagcttccagcactttgccactcag
gccatccacgtgggaccagagccggagcaatggagttcgcgtgctgtggtgctgcccatt
tcgctggccaccacgttcaaacaggactctccaggccagtcctcgggttttgtatacagc
cgctctggaaatccgacgaggaattgcttggaaaaagcagtggctgcactggatggggca
aagcactgtttgaccttcgctcggggccttgccgccaccacaacgattacccatctttta
aaagcaggagatgaagtcatttgcatggatgaagtgtatggaggcaccaacaggtacttc
aggagggtggcatccgagtttggactgaagatttcttttgtggattgttccaaaaccaaa
ttgctggaggcagcgatcacaccacagaccaagcttgtttggattgaaacacccacaaac
ccaaccttgaagttggccgacatcaaagcctgcgcacaaattgtccacaaacacaaagac
atcattctggttgtagataacactttcatgtctgcatatttccagagacctttggctctg
ggtgctgatatttgtatgtgttctgccacaaaatacatgaacggccacagtgatgttgtc
atgggcttagtgtctgttacttccgatgacctcaacgaacggcttcgtttcctgcagaat
tctctcggggcagttccttctcctttcgattgttacctctgctgccgaggcctgaagaca
ctgcagatccggatggagaaacacttcaggaatgggatggcagtggcccgtttcctggag
tctaatccccgggtagaaaaggttatttatcctgggctaccgtctcaccctcagcatgag
ctcgccaaacgtcagtgcacgggctgccccgggatggtcagtttctatatcaagggtact
ctgcagcatgctcaggtcttcctcaaaaatataaagctgtttgctctggctgagagcctg
ggaggatatgagagtctggctgagcttccagcaatcatgacccatgcctccgtgcctgag
aaggacagagctaccctcgggatcagtgacacactgatccgactttctgtgggcctagag
gatgaaaaggaccttctcgaagacctgggtcaagctttaaaggcagcgcacccttaa

DBGET integrated database retrieval system