KEGG   Rattus norvegicus (rat): 24963
Entry
24963             CDS       T01003                                 

Gene name
Hspa1l
Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno04010  MAPK signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04144  Endocytosis
rno04213  Longevity regulating pathway - multiple species
rno04612  Antigen processing and presentation
rno04915  Estrogen signaling pathway
rno05020  Prion disease
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05162  Measles
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    24963 (Hspa1l)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    24963 (Hspa1l)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24963 (Hspa1l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24963 (Hspa1l)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    24963 (Hspa1l)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24963 (Hspa1l)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    24963 (Hspa1l)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    24963 (Hspa1l)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    24963 (Hspa1l)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24963 (Hspa1l)
  09164 Neurodegenerative disease
   05020 Prion disease
    24963 (Hspa1l)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24963 (Hspa1l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24963 (Hspa1l)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    24963 (Hspa1l)
   03009 Ribosome biogenesis [BR:rno03009]
    24963 (Hspa1l)
   03110 Chaperones and folding catalysts [BR:rno03110]
    24963 (Hspa1l)
   04131 Membrane trafficking [BR:rno04131]
    24963 (Hspa1l)
   03051 Proteasome [BR:rno03051]
    24963 (Hspa1l)
   03029 Mitochondrial biogenesis [BR:rno03029]
    24963 (Hspa1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24963 (Hspa1l)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     24963 (Hspa1l)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    24963 (Hspa1l)
 Complex C
   Prp19-CDC5 complex
    24963 (Hspa1l)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    24963 (Hspa1l)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP70 / DNAK
   24963 (Hspa1l)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    24963 (Hspa1l)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    24963 (Hspa1l)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    24963 (Hspa1l)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    24963 (Hspa1l)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24963 (Hspa1l)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C DUF1464 Hydantoinase_A
Other DBs
NCBI-GeneID: 24963
NCBI-ProteinID: NP_997711
RGD: 1595925
Ensembl: ENSRNOG00000047966
Vega: OTTRNOG00000001813
UniProt: P55063
Position
20
AA seq 641 aa
MAANKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVLVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAA
KNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCSEVLSWLEANQLAEKEEFDHKRKE
LENMCNPIITKLYQSGCTGPTCAPGYTPGRAATGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggctgctaataaaggaatggccataggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacc
ccaagctacgtggccttcaccgacaccgagcggctcatcggggacgccgccaagaaccag
gtggccatgaatccccagaacactgtttttgacgccaaacgtctaattggcaggaagttt
aatgatcccgtcgtgcagtcggatatgaagctgtggccatttcaagtgatcaatgaagcg
ggcaagcctaaggtgctggtgtcctacaaaggagagaagaaagccttctacccggaggag
atctcgtccatggtgctgaccaagatgaaggagactgcagaggcttttttgggccacagt
gtcaccaacgctgtgatcaccgtgccagcctatttcaatgactcccagagacaggccact
aaagatgcaggggtcatcgcaggactcaacgtgctgcgaatcatcaatgagcccacagcg
gcggccatcgcctacggcttggataaaggaagtcacggagagcggcacgtgctcatcttc
gacctggggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgag
gtgaaggccacggcgggcgacacgcacctgggcggggaggacttcgacaaccggctggtg
agccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgc
gcggtgcggcgtctgcgcacggcgtgcgagagggccaagaggacgctgtcgtccagcacc
caggccaacctggagatcgactctctgtacgagggcatcgacttctacacgtccatcacg
cgggcgcggttcgaggagctgtgtgcagacctatttagaggcacgcttgagcccgtggag
aagtctctccgggacgccaagatggacaaggctaaaatccatgacattgttctagtaggg
ggctctacccgcatcccaaaggtgcaaaagctgcttcaagactactttaatggacgggat
ctcaacaagagtatcaatcccgatgaggcggtggcgtacggagctgcagtccaggcagct
attttaatgggcgacaaatctgaaaaagtacaggatttgcttttgttggacgtagctccc
ctgtctctaggattggagacagccgggggtgtgatgactgttctgatcaagcgcaactcc
accatccccaccaagcagacgcagatcttcaccacctactcggacaaccagcccggggtg
ctgatccaggtgtacgagggcgagagggccatgacgcgcgacaacaacctcctggggcgc
tttgacctgactggaataccccctgcacctaggggtgtgccccagatcgaggtgaccttc
gacatcgacgccaacgggattctcaacgtcacagccatggacaagagcaccggcaaggcc
aacaagatcaccatcaccaacgacaagggccgcttgagcaaggaggagatcgagcgcatg
gtgcaagaggccgagcggtacaaggccgaggacgagggccagagggagaagatcgctgcc
aaaaatgccttagaatcgtatgcctttaacatgaagagcgctgtaggcgatgagggtctg
aaggacaagatcagcgagtctgataaaaagaaaatactggataaatgcagtgaggtcctt
tcctggctggaggccaaccagctggcggagaaagaagagttcgatcataaaagaaaagag
ctggaaaacatgtgcaaccctatcatcacaaagctgtaccagagcggctgcacagggccc
acctgcgcgccagggtatacacccggcagggctgccacaggccccaccattgaggaagta
gattag

DBGET integrated database retrieval system