KEGG   Rattus norvegicus (rat): 24968
Entry
24968             CDS       T01003                                 

Gene name
Psmb8, Lmp7, Ring10
Definition
(RefSeq) proteasome subunit beta 8
  KO
K02740  20S proteasome subunit beta 8 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    24968 (Psmb8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24968 (Psmb8)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    24968 (Psmb8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     24968 (Psmb8)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   24968 (Psmb8)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    24968 (Psmb8)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 24968
NCBI-ProteinID: NP_542945
RGD: 3426
Ensembl: ENSRNOG00000000456
Vega: OTTRNOG00000001671
UniProt: P28064 A0A023IMI6
Position
20p12
AA seq 276 aa
MALLDLCGAPRGQRPEWAAVDAGSGLRSDPGHYSFSVQAPELALPRGMQPTEFLRSFGDD
QERKVQIEMAHGTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKG
PGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLARRAIVYATHRDS
YSGGVVNMYHMKKDGWVKVESTDVSDLLHKYREATL
NT seq 831 nt   +upstreamnt  +downstreamnt
atggcgttactggatctgtgcggcgctcctcgggggcagcggcccgagtgggctgccgtg
gatgcaggaagcgggcttcgctcggacccgggacactacagtttctccgtgcaagctccg
gagctcgcgcttccccggggaatgcagcccactgaattcctaaggtcctttggtgatgac
caggaaaggaaggttcagattgaaatggcgcacggcacaaccacgctggccttcaagttc
cagcatggagtcatcgtggcggtggactccagggcctccgcaggaagttacattgctacc
ataagggtgaacaaggtgatcgagattaacccttacctgcttggaaccatgtctggttgt
gcagccgactgtcagtactgggagaggctgttggccaaggaatgcaggctatactatctg
cggaatggggaacgcatctccgtgtctgcagcctccaagctactttccaacatgatgctg
cagtaccggggtatgggcctctccatgggcagcatgatctgcggctgggacaagaaggga
ccgggactttattacgtagatgacaatgggactcggctctcgggacagatgttctccaca
ggcagcgggaacacctatgcctacggggtgatggacagtgggtaccggcaggatctcagt
cctgaggaggcctacgaccttgcccgaagagctattgtttatgctacccacagagacagc
tattctggaggagttgtcaacatgtaccacatgaagaaagacggttgggtgaaagtggag
agcactgacgtcagtgacctgctgcacaagtaccgagaggccactctgtga

DBGET integrated database retrieval system