KEGG   Rattus norvegicus (rat): 24981
Entry
24981             CDS       T01003                                 

Gene name
RT1-Db2
Definition
(RefSeq) RT1 class II, locus Db2 precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24981 (RT1-Db2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24981 (RT1-Db2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24981 (RT1-Db2)
   04612 Antigen processing and presentation
    24981 (RT1-Db2)
   04658 Th1 and Th2 cell differentiation
    24981 (RT1-Db2)
   04659 Th17 cell differentiation
    24981 (RT1-Db2)
   04672 Intestinal immune network for IgA production
    24981 (RT1-Db2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24981 (RT1-Db2)
   05164 Influenza A
    24981 (RT1-Db2)
   05168 Herpes simplex virus 1 infection
    24981 (RT1-Db2)
   05169 Epstein-Barr virus infection
    24981 (RT1-Db2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    24981 (RT1-Db2)
   05152 Tuberculosis
    24981 (RT1-Db2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24981 (RT1-Db2)
   05140 Leishmaniasis
    24981 (RT1-Db2)
  09163 Immune disease
   05310 Asthma
    24981 (RT1-Db2)
   05322 Systemic lupus erythematosus
    24981 (RT1-Db2)
   05323 Rheumatoid arthritis
    24981 (RT1-Db2)
   05320 Autoimmune thyroid disease
    24981 (RT1-Db2)
   05321 Inflammatory bowel disease
    24981 (RT1-Db2)
   05330 Allograft rejection
    24981 (RT1-Db2)
   05332 Graft-versus-host disease
    24981 (RT1-Db2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24981 (RT1-Db2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24981 (RT1-Db2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24981 (RT1-Db2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24981 (RT1-Db2)
  Exosomal proteins of epithelial cells
   24981 (RT1-Db2)
  Exosomal proteins of breast milk
   24981 (RT1-Db2)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig C2-set_2 Tricorn_C1 YtpI
Other DBs
NCBI-GeneID: 24981
NCBI-ProteinID: NP_001158298
RGD: 1595922
Ensembl: ENSRNOG00000030431
Vega: OTTRNOG00000001678
Position
20
AA seq 286 aa
MVCLWLPRDPCVAAVVLSLLMLSPPVALVRDPRPRFLEQLKAECHYVKGREHVWSVTRFI
YNQEEFARFDSVFGKFLAVTELGRPIAEYLNTQKDMLDNYRASVDRCRNNYDLVDIFMSN
LKAKPKVTVYPSKTQPLEYHNLLVCSVSDFYPGTIEIRWFRNGEEEKTGVVSTDLISNGD
WTYQTLVMLETVPQGGEVYTCQVEHPSLTSPVRVEWRARSTSAQNKMLSGAMGMALGLFI
LAVGLFIYLRNLRGSVSHGAGEGAESSTSRLTGSRSECHTGPALSV
NT seq 861 nt   +upstreamnt  +downstreamnt
atggtgtgtctgtggctccccagagacccctgtgtggcggctgtggtcctgagtctgtta
atgctgagtcctcccgtggctttggtcagggacccccgaccacgttttctggagcagttg
aaggctgagtgtcactacgtcaaggggagggagcatgtgtggagcgtgaccagattcatc
tataaccaggaagagtttgcccgctttgacagtgtctttgggaagttcctggcagtgact
gagctggggcggcccatagctgagtacttgaacacccagaaggacatgctggacaattac
cgtgcctctgtggacaggtgcagaaataactatgacctggttgatatcttcatgtcgaac
ttaaaagctaaacccaaggtgaccgtgtacccttcaaagacgcagcccctggaataccac
aacctcctggtctgctctgtgagtgacttctaccctggcaccattgaaatcagatggttc
cggaatggtgaggaggaaaagactggagtcgtgtccaccgacctgatctctaatggagac
tggacctaccagaccctggtgatgctggagacggttcctcagggtggagaggtttacacc
tgccaggtggagcatcccagcctgaccagccctgtcagagtggagtggagggctcgatcc
acatctgcacagaacaagatgctgagcggagccatgggcatggcgctaggtctgttcatc
ctcgcggtggggctgttcatctacttaaggaatctgagaggatcagtgtctcatggtgct
ggagaaggagccgagagttccacatccagattgacgggcagcaggagtgaatgtcacact
gggcctgcattgagcgtctga

KEGG   Rattus norvegicus (rat): 24984
Entry
24984             CDS       T01003                                 

Gene name
RT1-DOa
Definition
(RefSeq) RT1 class II, locus DOa precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24984 (RT1-DOa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24984 (RT1-DOa)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24984 (RT1-DOa)
   04612 Antigen processing and presentation
    24984 (RT1-DOa)
   04658 Th1 and Th2 cell differentiation
    24984 (RT1-DOa)
   04659 Th17 cell differentiation
    24984 (RT1-DOa)
   04672 Intestinal immune network for IgA production
    24984 (RT1-DOa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24984 (RT1-DOa)
   05164 Influenza A
    24984 (RT1-DOa)
   05168 Herpes simplex virus 1 infection
    24984 (RT1-DOa)
   05169 Epstein-Barr virus infection
    24984 (RT1-DOa)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    24984 (RT1-DOa)
   05152 Tuberculosis
    24984 (RT1-DOa)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24984 (RT1-DOa)
   05140 Leishmaniasis
    24984 (RT1-DOa)
  09163 Immune disease
   05310 Asthma
    24984 (RT1-DOa)
   05322 Systemic lupus erythematosus
    24984 (RT1-DOa)
   05323 Rheumatoid arthritis
    24984 (RT1-DOa)
   05320 Autoimmune thyroid disease
    24984 (RT1-DOa)
   05321 Inflammatory bowel disease
    24984 (RT1-DOa)
   05330 Allograft rejection
    24984 (RT1-DOa)
   05332 Graft-versus-host disease
    24984 (RT1-DOa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24984 (RT1-DOa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24984 (RT1-DOa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24984 (RT1-DOa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24984 (RT1-DOa)
  Exosomal proteins of epithelial cells
   24984 (RT1-DOa)
  Exosomal proteins of breast milk
   24984 (RT1-DOa)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 24984
NCBI-ProteinID: NP_898874
RGD: 3477
Ensembl: ENSRNOG00000026762
Vega: OTTRNOG00000001665
UniProt: Q6MGB0
Position
20
AA seq 250 aa
MVLFVELVQVFLTIMSFLGPRGVWAIKADHMGSYGPAFYQSYDASGQFTHEFDGEQIFSV
DLKKGEVVWRLPEFADFAYSDFQSGLMSISMIRAHLDVLVERSNRTRAVSVPPRVTVFPK
SRVELGKPNVLICMVEDIFPPVINITWLRNSQPITKGVTQTSFYSQPNHRFRKFHYLTFV
PTAEDVYDCRVEHWGLDAPLLQHWEPQVLTPPPDTTETLICGLGLALGLVGCLLGTLLMV
TATRMPSTRR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctctttgtggagctggtccaggtatttctaaccataatgagcttcctgggtccc
cggggagtatgggccatcaaggccgaccacatgggctcctacggaccagccttctaccag
tcttacgacgcctccggacagttcacacacgaatttgacggggaacagattttctctgtg
gatctgaagaagggggaggtcgtgtggcgtctgcccgagtttgcagacttcgcgtactcg
gactttcagagcgggctgatgagcatctccatgatcagagctcatctggacgtcttggta
gaacgctccaaccgaaccagagccgtcagtgtgcctccccgggtgaccgtattccccaag
tctcgcgtggagctgggaaaacccaatgtcctcatctgcatggtggaagatatcttcccg
cctgtgatcaatatcacctggctgcgcaacagccagcccatcactaagggagtgacccag
accagcttctactcccagcctaaccacaggttccggaagttccactacctgaccttcgtg
cccacggcggaggatgtgtacgactgcagggtggagcactggggcctggacgcaccgctc
ctccagcactgggagccccaggtgcttaccccaccaccggacaccacagagaccctgatc
tgtggcctgggcctggctctcggccttgtgggatgcctcctgggcaccttgctcatggtc
acagccacacgcatgcccagtacccgcaggtga

KEGG   Rattus norvegicus (rat): 24986
Entry
24986             CDS       T01003                                 

Gene name
RT1-Ha
Definition
(RefSeq) RT1 class II, locus Ha precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24986 (RT1-Ha)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24986 (RT1-Ha)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24986 (RT1-Ha)
   04612 Antigen processing and presentation
    24986 (RT1-Ha)
   04658 Th1 and Th2 cell differentiation
    24986 (RT1-Ha)
   04659 Th17 cell differentiation
    24986 (RT1-Ha)
   04672 Intestinal immune network for IgA production
    24986 (RT1-Ha)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24986 (RT1-Ha)
   05164 Influenza A
    24986 (RT1-Ha)
   05168 Herpes simplex virus 1 infection
    24986 (RT1-Ha)
   05169 Epstein-Barr virus infection
    24986 (RT1-Ha)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    24986 (RT1-Ha)
   05152 Tuberculosis
    24986 (RT1-Ha)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24986 (RT1-Ha)
   05140 Leishmaniasis
    24986 (RT1-Ha)
  09163 Immune disease
   05310 Asthma
    24986 (RT1-Ha)
   05322 Systemic lupus erythematosus
    24986 (RT1-Ha)
   05323 Rheumatoid arthritis
    24986 (RT1-Ha)
   05320 Autoimmune thyroid disease
    24986 (RT1-Ha)
   05321 Inflammatory bowel disease
    24986 (RT1-Ha)
   05330 Allograft rejection
    24986 (RT1-Ha)
   05332 Graft-versus-host disease
    24986 (RT1-Ha)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24986 (RT1-Ha)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24986 (RT1-Ha)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24986 (RT1-Ha)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24986 (RT1-Ha)
  Exosomal proteins of epithelial cells
   24986 (RT1-Ha)
  Exosomal proteins of breast milk
   24986 (RT1-Ha)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2
Other DBs
NCBI-GeneID: 24986
NCBI-ProteinID: NP_001008848
RGD: 1595921
Ensembl: ENSRNOG00000026669
Vega: OTTRNOG00000001664
UniProt: Q6MGB1
Position
20
AA seq 254 aa
MFQTKAEALRASFLAFLLSLPGSGAIKAEHVATYDIFVQTQHPSGECMYAFDGDEQFYVD
LDREETVWDLPEFSKVYAFDAQEALPYIDSLKNNLRALIQRYNVTQDPSEPPEVTVFPKN
PVELGQPNVLICHIDRLFPPVLNVTWLRNGQPVTEGTSETVFLASTELRFHKFHYLTFIP
TAQDVYDCRVEHWSLDQPSLSHWEMQEPVQVSETMETTVCALGLVVGLVGSVVGSALIVR
APHGGHNPRTQEPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgttccagactaaagctgaggccctgagagcctccttcctggccttcctgctgagtctc
ccaggatctggggccatcaaagcggagcacgtagcaacgtacgacatatttgtgcagacg
cagcacccgtctggtgaatgcatgtacgcgtttgacggtgatgagcagttctacgtggat
cttgacagggaggagacggtctgggacctgccggagttcagcaaggtgtatgcgtttgac
gcccaggaggctcttccctacatcgacagcctgaagaacaacttgagagccttgatccag
agatacaacgtcacccaggaccccagcgagcctcccgaggtgaccgtgttccctaagaac
ccggtagagctgggccagcccaatgtcctcatctgccacatcgacaggctctttccccca
gtgctcaatgtcacatggctacgtaacgggcagccggtcaccgaaggaacttcagagacc
gtctttctggccagcacagaactcagatttcacaagttccactacctgaccttcattccc
acagcgcaggatgtgtatgactgcagggtggagcactggagcctggaccagccgagtctc
agtcactgggaaatgcaggagccagtccaggtgtccgagacaatggagaccacggtctgc
gccctgggcctggtggtgggcctggtgggctccgtggttggtagtgcgctcatcgtaagg
gctccgcatggcggccataaccctcggacccaggaacccctgtga

KEGG   Rattus norvegicus (rat): 294269
Entry
294269            CDS       T01003                                 

Gene name
RT1-Da
Definition
(RefSeq) RT1 class II, locus Da precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    294269 (RT1-Da)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    294269 (RT1-Da)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    294269 (RT1-Da)
   04612 Antigen processing and presentation
    294269 (RT1-Da)
   04658 Th1 and Th2 cell differentiation
    294269 (RT1-Da)
   04659 Th17 cell differentiation
    294269 (RT1-Da)
   04672 Intestinal immune network for IgA production
    294269 (RT1-Da)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    294269 (RT1-Da)
   05164 Influenza A
    294269 (RT1-Da)
   05168 Herpes simplex virus 1 infection
    294269 (RT1-Da)
   05169 Epstein-Barr virus infection
    294269 (RT1-Da)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    294269 (RT1-Da)
   05152 Tuberculosis
    294269 (RT1-Da)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    294269 (RT1-Da)
   05140 Leishmaniasis
    294269 (RT1-Da)
  09163 Immune disease
   05310 Asthma
    294269 (RT1-Da)
   05322 Systemic lupus erythematosus
    294269 (RT1-Da)
   05323 Rheumatoid arthritis
    294269 (RT1-Da)
   05320 Autoimmune thyroid disease
    294269 (RT1-Da)
   05321 Inflammatory bowel disease
    294269 (RT1-Da)
   05330 Allograft rejection
    294269 (RT1-Da)
   05332 Graft-versus-host disease
    294269 (RT1-Da)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    294269 (RT1-Da)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    294269 (RT1-Da)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294269 (RT1-Da)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   294269 (RT1-Da)
  Exosomal proteins of epithelial cells
   294269 (RT1-Da)
  Exosomal proteins of breast milk
   294269 (RT1-Da)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 294269
NCBI-ProteinID: NP_001008847
RGD: 1593283
Ensembl: ENSRNOG00000032844
Vega: OTTRNOG00000001680
UniProt: Q6MG98
Position
20
AA seq 255 aa
MATLGDLVIRFFFMAVLMSPQKSWAIREEHTIIQAEFYLSPDQNGEFMFDFDGDEIFHVD
IKKSETIWRLEEFAQFASFEAQGALANIAVDKANLDIMIKRSNNTPDANVIPEVTVLPKS
PVNLGEPNILICFIDKFSPPAVNVTWLRNGQPVTKGVSETVFLPREDHLFRKFHYLTFLP
STEDYYDCEVDHWGLEEPLRKHWEFEEKTLLPETKENVLCVLGLFVGLVGIVVGIVLIIK
GLRKRNAVERRQGAL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggccacacttggagacctggtgataagatttttcttcatggctgtcctcatgagcccc
cagaagtcgtgggctatcagagaggagcacaccatcatccaggcggagttctatctttcc
cccgaccaaaatggagagttcatgtttgactttgacggtgacgagattttccatgtagat
attaaaaagtcagagaccatctggagacttgaagaatttgcacagtttgccagctttgag
gctcagggtgcattggctaatatagctgtggacaaagctaacctggacatcatgataaag
cgctccaacaacactccagatgccaatgtgattccagaggtgactgtactccccaaaagc
ccggtgaacctgggagagcccaacatcctcatctgtttcattgacaagttctcccctcca
gcggtcaatgtcacctggcttcggaacggacaacctgtcaccaaaggcgtgtcagagacg
gtgtttctcccaagggaggaccacctcttccgcaaattccactatctgaccttcctgccc
tccacggaagattactatgactgtgaggtggatcactggggtctggaggagcctctgcgg
aagcactgggagtttgaagagaaaaccctcctcccagaaactaaagagaatgtcctgtgt
gttctcgggttgtttgtgggtctggtaggcatcgtcgtcgggattgtgctcatcatcaag
ggccttcggaaacgcaacgcagtggaacggcgccaaggagccctgtga

KEGG   Rattus norvegicus (rat): 294270
Entry
294270            CDS       T01003                                 

Gene name
RT1-Db1
Definition
(RefSeq) rano class II histocompatibility antigen, D-1 beta chain precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    294270 (RT1-Db1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    294270 (RT1-Db1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    294270 (RT1-Db1)
   04612 Antigen processing and presentation
    294270 (RT1-Db1)
   04658 Th1 and Th2 cell differentiation
    294270 (RT1-Db1)
   04659 Th17 cell differentiation
    294270 (RT1-Db1)
   04672 Intestinal immune network for IgA production
    294270 (RT1-Db1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    294270 (RT1-Db1)
   05164 Influenza A
    294270 (RT1-Db1)
   05168 Herpes simplex virus 1 infection
    294270 (RT1-Db1)
   05169 Epstein-Barr virus infection
    294270 (RT1-Db1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    294270 (RT1-Db1)
   05152 Tuberculosis
    294270 (RT1-Db1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    294270 (RT1-Db1)
   05140 Leishmaniasis
    294270 (RT1-Db1)
  09163 Immune disease
   05310 Asthma
    294270 (RT1-Db1)
   05322 Systemic lupus erythematosus
    294270 (RT1-Db1)
   05323 Rheumatoid arthritis
    294270 (RT1-Db1)
   05320 Autoimmune thyroid disease
    294270 (RT1-Db1)
   05321 Inflammatory bowel disease
    294270 (RT1-Db1)
   05330 Allograft rejection
    294270 (RT1-Db1)
   05332 Graft-versus-host disease
    294270 (RT1-Db1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    294270 (RT1-Db1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    294270 (RT1-Db1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294270 (RT1-Db1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   294270 (RT1-Db1)
  Exosomal proteins of epithelial cells
   294270 (RT1-Db1)
  Exosomal proteins of breast milk
   294270 (RT1-Db1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Marek_A DUF202
Other DBs
NCBI-GeneID: 294270
NCBI-ProteinID: NP_001008884
RGD: 1593282
Ensembl: ENSRNOG00000033215
Vega: OTTRNOG00000001676
UniProt: Q9TQA6
Position
20
AA seq 264 aa
MVWLARDSCVAAVILLLTVLSPPVALVRDPTPRFLEQYKSECYFYNGTQRVRLLVRYIYN
REEYTRFDSDVGEFRAVTELGRRDTEYYNKQKEYIERERAAVDTICRHNYEISDRFLVPR
TVEPKVTVYPSKTQPLKHHNLLVCSVSDFYPGSVEVRWFRNGEEEKDGLVSTGLIPNGDW
TFQLLVMLEMVPQGGEVYTCQVEHPSLTSPVRVEWKAQSTSAQNKKMSGVGGIVLGLLFL
GAGLFVYFRNQKGQSGLQPTGLLN
NT seq 795 nt   +upstreamnt  +downstreamnt
atggtgtggctcgccagagattcctgtgtggcagctgtgatcctgttgctaacagtgctg
agccctccggtggcgttggtcagagaccccacgccacggtttttggaacagtataaatcc
gagtgttatttttacaacgggacgcagcgcgtacggcttctggtcagatacatctacaac
cgggaggagtacacgcgcttcgacagcgacgtgggcgagttccgcgcggtgaccgagctg
gggcggcgggacaccgagtactataacaaacagaaggagtacatagagcgggagagggcc
gcggtggacacgatctgcagacacaactacgagatctctgatagattccttgtgccgcgg
acagttgaacccaaggtgactgtgtacccttcaaagacgcagcccctgaaacaccacaac
ctcctggtctgctctgtgagtgacttctaccctggcagcgttgaagtcagatggttccgg
aatggcgaggaagaaaaggatggactcgtgtccactggcctgatcccaaatggagactgg
accttccagttgttggtgatgctggagatggttcctcaaggtggagaggtttatacctgc
caggtggagcatcccagcctgaccagccctgtcagagtcgagtggaaagcacagtccacg
tctgcacaaaataagaagatgagtggagtcgggggcatcgtgctgggtctgctcttcctg
ggagccgggctgttcgtctacttcaggaaccagaaaggacagtctggacttcagccaaca
ggactcctgaactga

KEGG   Rattus norvegicus (rat): 294273
Entry
294273            CDS       T01003                                 

Gene name
RT1-DMb
Definition
(RefSeq) RT1 class II, DM beta precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    294273 (RT1-DMb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    294273 (RT1-DMb)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    294273 (RT1-DMb)
   04612 Antigen processing and presentation
    294273 (RT1-DMb)
   04658 Th1 and Th2 cell differentiation
    294273 (RT1-DMb)
   04659 Th17 cell differentiation
    294273 (RT1-DMb)
   04672 Intestinal immune network for IgA production
    294273 (RT1-DMb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    294273 (RT1-DMb)
   05164 Influenza A
    294273 (RT1-DMb)
   05168 Herpes simplex virus 1 infection
    294273 (RT1-DMb)
   05169 Epstein-Barr virus infection
    294273 (RT1-DMb)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    294273 (RT1-DMb)
   05152 Tuberculosis
    294273 (RT1-DMb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    294273 (RT1-DMb)
   05140 Leishmaniasis
    294273 (RT1-DMb)
  09163 Immune disease
   05310 Asthma
    294273 (RT1-DMb)
   05322 Systemic lupus erythematosus
    294273 (RT1-DMb)
   05323 Rheumatoid arthritis
    294273 (RT1-DMb)
   05320 Autoimmune thyroid disease
    294273 (RT1-DMb)
   05321 Inflammatory bowel disease
    294273 (RT1-DMb)
   05330 Allograft rejection
    294273 (RT1-DMb)
   05332 Graft-versus-host disease
    294273 (RT1-DMb)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    294273 (RT1-DMb)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    294273 (RT1-DMb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294273 (RT1-DMb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   294273 (RT1-DMb)
  Exosomal proteins of epithelial cells
   294273 (RT1-DMb)
  Exosomal proteins of breast milk
   294273 (RT1-DMb)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 I-set C2-set_2 ig HU-CCDC81_bac_1
Other DBs
NCBI-GeneID: 294273
NCBI-ProteinID: NP_942035
RGD: 735096
Ensembl: ENSRNOG00000049491
Vega: OTTRNOG00000001668
UniProt: Q6MGA7
Position
20
AA seq 261 aa
MAALWPLLLALSLGCIGAGGFVAHVESTCLLDDEGTPMDFTYCISFNKDLLACWDPEEGQ
IVPCEYGVLFKLAEFISNILNKEEGLIQRLKNGLQDCSTHTQPFWNALTHRTRTPSVQVA
QTAPFNTREPVMLACYVWGFYPADVTVVWMKNGQLVTSHSNKEKTAQPNGDWTYQTVSYL
ALTPSYWDIYTCVVQHSGTPEPIRANWTPGLSPIQTVKVSVSAATLGLGFIIFCLGFFRW
RKSHSSSYTPLPGSTYPEGRP
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgcactatggccgctgctgctggccctgagtctgggttgtataggagcaggtggc
tttgtggctcatgtggaaagcacgtgcttgctggatgatgaagggaccccaatggacttc
acatactgtatttccttcaacaaagatctgctggcctgctgggatccagaggagggacaa
atagtcccctgtgaatatggggtcctgtttaagttggccgaattcatttcaaatatcctc
aacaaggaagaaggcctgatccagcgcttgaaaaatgggcttcaggactgttccacacac
acccagcccttctggaacgcgctgacccacagaaccagaacgccatctgtccaagtagcc
caaaccgctccttttaacacaagggagcctgtgatgctggcctgctacgtctggggcttc
tatccggcggatgtgaccgtcgtgtggatgaagaacgggcagcttgttacttcccacagc
aacaaggagaagacggctcagcctaatggggactggacataccagaccgtctcctaccta
gccttaaccccttcctactgggacatctacacctgcgtggtacagcacagcgggacccct
gagcccatccgcgcgaactggacacccgggctgtcccccatccagacagtgaaggtctct
gtgtctgcagccaccctgggcctgggcttcatcatcttctgtcttggcttcttcagatgg
cgcaagtctcactcctccagctacactcctctccctggatccacctacccggaaggacgg
ccctag

KEGG   Rattus norvegicus (rat): 294274
Entry
294274            CDS       T01003                                 

Gene name
RT1-DMa
Definition
(RefSeq) RT1 class II, DM alpha precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    294274 (RT1-DMa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    294274 (RT1-DMa)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    294274 (RT1-DMa)
   04612 Antigen processing and presentation
    294274 (RT1-DMa)
   04658 Th1 and Th2 cell differentiation
    294274 (RT1-DMa)
   04659 Th17 cell differentiation
    294274 (RT1-DMa)
   04672 Intestinal immune network for IgA production
    294274 (RT1-DMa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    294274 (RT1-DMa)
   05164 Influenza A
    294274 (RT1-DMa)
   05168 Herpes simplex virus 1 infection
    294274 (RT1-DMa)
   05169 Epstein-Barr virus infection
    294274 (RT1-DMa)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    294274 (RT1-DMa)
   05152 Tuberculosis
    294274 (RT1-DMa)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    294274 (RT1-DMa)
   05140 Leishmaniasis
    294274 (RT1-DMa)
  09163 Immune disease
   05310 Asthma
    294274 (RT1-DMa)
   05322 Systemic lupus erythematosus
    294274 (RT1-DMa)
   05323 Rheumatoid arthritis
    294274 (RT1-DMa)
   05320 Autoimmune thyroid disease
    294274 (RT1-DMa)
   05321 Inflammatory bowel disease
    294274 (RT1-DMa)
   05330 Allograft rejection
    294274 (RT1-DMa)
   05332 Graft-versus-host disease
    294274 (RT1-DMa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    294274 (RT1-DMa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    294274 (RT1-DMa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294274 (RT1-DMa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   294274 (RT1-DMa)
  Exosomal proteins of epithelial cells
   294274 (RT1-DMa)
  Exosomal proteins of breast milk
   294274 (RT1-DMa)
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 294274
NCBI-ProteinID: NP_942036
RGD: 735053
Ensembl: ENSRNOG00000047854
Vega: OTTRNOG00000001667
UniProt: Q95574
Position
20
AA seq 260 aa
MEHEQKSGGLLRLLRLLWLLPHSWAVLEASPQAWWDESQNHTFRHTLFCQDGFPNIGLSE
TYDEDALFSFDFSQNTRVPRLPEFAEWAQEQGDASAIAFDKGFCDMLMQNVSPRLEGQIP
VSRGLPSAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVTWQHHFVPVEGASPTSVSAIDG
LTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLGV
LGLVVGIVFFIRSQRPCSGD
NT seq 783 nt   +upstreamnt  +downstreamnt
atggagcatgagcagaagtcaggagggctgctgaggctgctgcggcttctgtggctgctg
cctcactcctgggcggtgcttgaagcttctccccaggcgtggtgggatgagtcgcagaac
cacacattccgtcacactctgttctgccaggatgggtttcccaacatagggctctccgag
acctacgacgaggacgcactcttctccttcgacttctcccagaacaccagagtgccccgg
ctgcctgagtttgctgagtgggctcaggaacagggagatgcctctgccattgcgtttgac
aaaggcttctgcgacatgttgatgcagaatgtgagcccgcggcttgaaggtcaaatccca
gtgtccagaggtttgccttcggctgaggtgttcaccctgaagcccctggagtttggcaag
cccaacacgctggtctgtttcatcagcaacctctttccaccgactttgacggtgacctgg
cagcatcatttcgtccccgtggagggagccagccccacatccgtttcagccatcgatggg
ctcaccttccaggccttctcttatttaaacttcacaccggaacccttcgacctttactcc
tgcactgtgacgcacgagattgaccgctacacggcgattgcctattgggtaccccagaac
gccctgccttcagatctcctggagaatgtactgtgcggtgtggccttcggcctcggtgtg
ctgggcctcgtcgtgggcattgtcttcttcatccgctcccagagaccttgctcaggggac
tga

KEGG   Rattus norvegicus (rat): 309621
Entry
309621            CDS       T01003                                 

Gene name
RT1-Ba
Definition
(RefSeq) rano class II histocompatibility antigen, B alpha chain precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309621 (RT1-Ba)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    309621 (RT1-Ba)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    309621 (RT1-Ba)
   04612 Antigen processing and presentation
    309621 (RT1-Ba)
   04658 Th1 and Th2 cell differentiation
    309621 (RT1-Ba)
   04659 Th17 cell differentiation
    309621 (RT1-Ba)
   04672 Intestinal immune network for IgA production
    309621 (RT1-Ba)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309621 (RT1-Ba)
   05164 Influenza A
    309621 (RT1-Ba)
   05168 Herpes simplex virus 1 infection
    309621 (RT1-Ba)
   05169 Epstein-Barr virus infection
    309621 (RT1-Ba)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    309621 (RT1-Ba)
   05152 Tuberculosis
    309621 (RT1-Ba)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    309621 (RT1-Ba)
   05140 Leishmaniasis
    309621 (RT1-Ba)
  09163 Immune disease
   05310 Asthma
    309621 (RT1-Ba)
   05322 Systemic lupus erythematosus
    309621 (RT1-Ba)
   05323 Rheumatoid arthritis
    309621 (RT1-Ba)
   05320 Autoimmune thyroid disease
    309621 (RT1-Ba)
   05321 Inflammatory bowel disease
    309621 (RT1-Ba)
   05330 Allograft rejection
    309621 (RT1-Ba)
   05332 Graft-versus-host disease
    309621 (RT1-Ba)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309621 (RT1-Ba)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    309621 (RT1-Ba)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309621 (RT1-Ba)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   309621 (RT1-Ba)
  Exosomal proteins of epithelial cells
   309621 (RT1-Ba)
  Exosomal proteins of breast milk
   309621 (RT1-Ba)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 SKG6 Ig_2
Other DBs
NCBI-GeneID: 309621
NCBI-ProteinID: NP_001008831
RGD: 1595867
Ensembl: ENSRNOG00000000451
Vega: OTTRNOG00000001675
UniProt: Q6MGA0
Position
20
AA seq 255 aa
MPLSRALILGVLALTTMLSPCGGQDDIEADHVAAYGINMYQYYESRGQYTHEFDGDEEFY
VDLDKKETIWRIPEFGQLTSFDPQGGLQEIATAKYNLEILMKSNSTPATNKVPEATVFSK
SPVLLGQPNTLICFVDNIFPPAINITWLRNSKPVTEGTFETSFLSNPDHSFHKMAYLTFI
PSNDDIYDCKVEHWGLDEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFII
QGLRSGGPSRHPGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgccgctcagcagagctctgattttgggggtcctcgccctgaccaccatgctcagcccc
tgtggaggtcaagacgacattgaggccgaccacgtagccgcctatggtataaatatgtat
cagtattatgaatccagaggccagtacacacatgaatttgatggtgacgaggaattctat
gtggacttggataagaaggagaccatctggaggatccccgagtttggacaactgacaagc
tttgacccccaaggtggacttcaagagatagctacagcaaaatacaatttggaaatcctg
atgaagtcaaattcaaccccagctaccaacaaggttcctgaggcgaccgtgttttccaag
tcccctgtgctgctgggtcagcccaacaccctcatctgctttgtagacaacatctttcct
cctgcgatcaatatcacgtggttgagaaacagcaagccagtcacagaaggcacttttgag
accagcttcctctccaaccctgaccattccttccacaagatggcttacctcaccttcatc
ccttctaacgatgacatttatgactgcaaggtggagcactggggcctcgacgagccggtt
ctaaaacactgggaacctgagattccagcccccatgtcagagctgacagagactgtggtc
tgtgccctggggttgtctgtgggcctcgtgggcatcgtggtgggcaccatcttcatcatt
caaggcctgcggtcaggtggcccctccagacacccagggcccttgtga

KEGG   Rattus norvegicus (rat): 309622
Entry
309622            CDS       T01003                                 

Gene name
RT1-Bb
Definition
(RefSeq) rano class II histocompatibility antigen, B-1 beta chain precursor
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309622 (RT1-Bb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    309622 (RT1-Bb)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    309622 (RT1-Bb)
   04612 Antigen processing and presentation
    309622 (RT1-Bb)
   04658 Th1 and Th2 cell differentiation
    309622 (RT1-Bb)
   04659 Th17 cell differentiation
    309622 (RT1-Bb)
   04672 Intestinal immune network for IgA production
    309622 (RT1-Bb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309622 (RT1-Bb)
   05164 Influenza A
    309622 (RT1-Bb)
   05168 Herpes simplex virus 1 infection
    309622 (RT1-Bb)
   05169 Epstein-Barr virus infection
    309622 (RT1-Bb)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    309622 (RT1-Bb)
   05152 Tuberculosis
    309622 (RT1-Bb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    309622 (RT1-Bb)
   05140 Leishmaniasis
    309622 (RT1-Bb)
  09163 Immune disease
   05310 Asthma
    309622 (RT1-Bb)
   05322 Systemic lupus erythematosus
    309622 (RT1-Bb)
   05323 Rheumatoid arthritis
    309622 (RT1-Bb)
   05320 Autoimmune thyroid disease
    309622 (RT1-Bb)
   05321 Inflammatory bowel disease
    309622 (RT1-Bb)
   05330 Allograft rejection
    309622 (RT1-Bb)
   05332 Graft-versus-host disease
    309622 (RT1-Bb)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309622 (RT1-Bb)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    309622 (RT1-Bb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309622 (RT1-Bb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   309622 (RT1-Bb)
  Exosomal proteins of epithelial cells
   309622 (RT1-Bb)
  Exosomal proteins of breast milk
   309622 (RT1-Bb)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Marek_A C2-set_2 ig DUF3592 MHC_I
Other DBs
NCBI-GeneID: 309622
NCBI-ProteinID: NP_001004084
RGD: 3469
Ensembl: ENSRNOG00000032708
Vega: OTTRNOG00000001674
UniProt: Q6AYB1
Position
20
AA seq 263 aa
MALQTPSFLLPAAVVVLMVLSSPGTEGRDSPRDFVFQFKGLCYYTNGTQRIRLVIRYIYN
REEYVRFDSDVGEFRALTELGRPSAEYYNKQYLERTRAELDTVCRHNYEETEVPTSLRRL
EQPNVAISLSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNGQEETAGVVSTQLIRNGDWT
FQILVMLEMTPQRGEVYICHVDHPSLESPVTVEWRAQSESAQSKMLSGIGGFVLGVIFLG
LGLFIRHKRQKGPRGPPPAGLLQ
NT seq 792 nt   +upstreamnt  +downstreamnt
atggctctgcagacccccagcttcctcctcccggcagctgtggttgtgctgatggtgctg
agcagcccagggactgagggcagagactccccaagggatttcgtattccagttcaagggc
ctgtgctactacaccaacgggacgcagcgcatacggctcgtgatcagatacatctacaac
cgggaggagtacgtgcgcttcgacagcgacgtgggcgagttccgcgcgctgaccgagctg
gggcggccctcagccgagtactataacaaacagtacctggagcggacgcgggccgagctg
gacacggtctgcagacacaactacgaggagacggaggtccccacctccctgcggcggctt
gagcagcccaatgtggccatctccctgtccaggacagaggccctcaaccaccacaacttg
ctggtctgctcagtgacagatttctacccagcccagatcaaagtgcgctggttccggaat
ggccaggaggagacggcgggggtcgtgtccacacagcttattaggaacggggactggacc
ttccagatcctggtcatgctggagatgacgcctcagcggggagaggtgtacatctgccat
gttgaccaccccagcctcgagagccccgtcacagtggagtggcgggcacagtccgagtct
gcccagagcaagatgctgagcggcatcgggggctttgtgctgggggtgatcttcctcggg
cttggccttttcatccgtcacaagcgtcagaaaggacctcgggggcctcctccagcaggg
ctcctacagtga

KEGG   Rattus norvegicus (rat): 365542
Entry
365542            CDS       T01003                                 

Gene name
RT1-DOb
Definition
(RefSeq) RT1 class II, DO beta
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    365542 (RT1-DOb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    365542 (RT1-DOb)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    365542 (RT1-DOb)
   04612 Antigen processing and presentation
    365542 (RT1-DOb)
   04658 Th1 and Th2 cell differentiation
    365542 (RT1-DOb)
   04659 Th17 cell differentiation
    365542 (RT1-DOb)
   04672 Intestinal immune network for IgA production
    365542 (RT1-DOb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    365542 (RT1-DOb)
   05164 Influenza A
    365542 (RT1-DOb)
   05168 Herpes simplex virus 1 infection
    365542 (RT1-DOb)
   05169 Epstein-Barr virus infection
    365542 (RT1-DOb)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    365542 (RT1-DOb)
   05152 Tuberculosis
    365542 (RT1-DOb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    365542 (RT1-DOb)
   05140 Leishmaniasis
    365542 (RT1-DOb)
  09163 Immune disease
   05310 Asthma
    365542 (RT1-DOb)
   05322 Systemic lupus erythematosus
    365542 (RT1-DOb)
   05323 Rheumatoid arthritis
    365542 (RT1-DOb)
   05320 Autoimmune thyroid disease
    365542 (RT1-DOb)
   05321 Inflammatory bowel disease
    365542 (RT1-DOb)
   05330 Allograft rejection
    365542 (RT1-DOb)
   05332 Graft-versus-host disease
    365542 (RT1-DOb)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    365542 (RT1-DOb)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    365542 (RT1-DOb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    365542 (RT1-DOb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   365542 (RT1-DOb)
  Exosomal proteins of epithelial cells
   365542 (RT1-DOb)
  Exosomal proteins of breast milk
   365542 (RT1-DOb)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 MHC_I
Other DBs
NCBI-GeneID: 365542
NCBI-ProteinID: NP_001008846
RGD: 1595814
Ensembl: ENSRNOG00000000454
Vega: OTTRNOG00000001673
UniProt: Q6MGA2
Position
20
AA seq 272 aa
MGAGRAPWVVALLVNLMRPDSFMVEGRDSPEDFVIQAKAECYFTNGTEKVRFLVRFIFNL
EEYLHFDSDLGFFVALTELGEVDADQWNKRLDLLETSRAAVNMVCRQEYKLGAPFTVERN
VPPEVTVYPERTPLLQQHNLLLCSVTDFYPGDISVRWFRNGQEERSGVMSTGLVRNGDWT
FQTTVMLEMIPELGDVYSCLVEHPGLLRPVSVAWVAQSEYSWEKILSGAAAFLLGLTVFL
VGAVIHLKAQKASVETQPGNEASRALLPPHPY
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggtgctgggagggccccctgggtggtggctctgctagtgaacctcatgaggccagat
tccttcatggttgaaggcagagactccccagaggattttgtgattcaggcgaaggcagag
tgttacttcaccaacggtacagaaaaggtccgcttcctggtcaggttcatcttcaacctg
gaggagtacttacatttcgacagtgacctggggtttttcgtggcactgacggagctgggg
gaggtggacgctgatcagtggaacaaacgcctggatctcctggaaacaagtagagctgct
gtgaacatggtctgcaggcaagagtacaagctgggggcccccttcaccgtggagagaaat
gtgcctccggaggtgacggtgtacccagagaggaccccattgctgcagcagcacaacctg
ttgctctgctctgtgacagacttctaccctggggacataagtgtcaggtggttccggaat
gggcaggaggagaggtccggggtcatgtccactggccttgttaggaatggagactggacc
ttccagacgacggtaatgctggaaatgatcccagagcttggagacgtctacagttgcctt
gtggagcaccccggcctcctgagacctgtttctgtggcatgggtggctcagtctgaatat
tcctgggaaaagatactgagtggagctgcagcattcctgcttgggctgactgtctttctg
gtgggagctgtcatccacctcaaggctcagaaagcgtccgtggagactcagcctggcaat
gaggcttcaagggcgcttctcccacctcacccctactaa

DBGET integrated database retrieval system