KEGG   Rattus norvegicus (rat): 25008Help
Entry
25008             CDS       T01003                                 

Gene name
Lta, Tnfb
Definition
(RefSeq) lymphotoxin alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04064  NF-kappa B signaling pathway
rno04668  TNF signaling pathway
rno04940  Type I diabetes mellitus
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    25008 (Lta)
   04668 TNF signaling pathway
    25008 (Lta)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25008 (Lta)
   04061 Viral protein interaction with cytokine and cytokine receptor
    25008 (Lta)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    25008 (Lta)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25008 (Lta)
   05168 Herpes simplex virus 1 infection
    25008 (Lta)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25008 (Lta)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   25008 (Lta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 25008
NCBI-ProteinID: NP_542947
RGD: 3020
Ensembl: ENSRNOG00000000838
Vega: OTTRNOG00000001729
UniProt: Q06332
Position
20p12
AA seq 202 aa AA seqDB search
MTPLGRLHLLRVLSTPPVFLLGLLLALPLGAQGLSGVRFSASRTAHQPPQKHLTHGLLKP
AAHLVGYPSKQNSLLWRANTDRAFLRHGFSLNNNSLLIPTSGLYFVYSQVVFSGESCSPR
AIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLST
HTDGISHLHFSPSTVFFGAFAL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacttggacgtctccacctcctgagggtgcttagcacccctcctgtcttcctc
ctggggctgctgctggccctgcctctaggggcccagggactctctggtgttcgcttctca
gcttccaggacagctcaccagccccctcagaagcacttgacccatggcctcctgaaacct
gccgctcaccttgttgggtaccccagcaaacagaattcactgctctggagagcaaacacg
gaccgcgcctttctccgacatggcttctctttgaacaacaactctctcctgatccccacc
agcggcctctactttgtctactcccaggtggttttctctggagaaagctgctcccccagg
gccattcctactcccatctacctggcccacgaggtccagctgttttcctcccagtacccc
ttccatgtgcctctcctcagcgcacagaaatctgtgtatccggggctacaaggaccgtgg
gtacgctcaatgtaccagggggctgtgttcctgctcagtaagggggaccagctgtccacc
cacacagacggcatctcccacttacacttcagccccagcaccgtgttttttggagctttt
gctctgtag

DBGET integrated database retrieval system