KEGG   Rattus norvegicus (rat): 25012Help
Entry
25012             CDS       T01003                                 

Gene name
Snap25, SNAP-25B, SNAP-25a
Definition
(RefSeq) synaptosomal-associated protein 25
  KO
K18211  synaptosomal-associated protein 25
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25012 (Snap25)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    25012 (Snap25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25012 (Snap25)
Membrane trafficking [BR:rno04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-25
    25012 (Snap25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNAP-25 DUF5089 Exonuc_VII_L Sec20 V-SNARE_C DUF349 XhlA
Motif
Other DBs
NCBI-GeneID: 25012
NCBI-ProteinID: NP_001257504
RGD: 3728
UniProt: P60881
Structure
PDB: 

Position
3q36
AA seq 206 aa AA seqDB search
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRV
EEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacgcagacatgcgtaatgaactggaggagatgcagaggagggctgaccag
ctggctgatgagtccctggaaagcacccgtcgcatgctgcagctggtcgaagagagtaaa
gatgctggcatcaggactttggttatgttggatgagcaaggcgaacaactcgatcgtgtc
gaagaaggcatgaaccatatcaaccaagacatgaaggaggccgagaaaaatttaaaagat
ttaggcaaatgctgtggccttttcatatgtccttgtaacaagcttaaatccagtgatgct
tacaaaaaagcctggggcaataatcaggatggagtagtggccagccagcctgcccgtgtg
gtggatgaacgggagcagatggccatcagtggtggcttcatccgcagggtaacaaacgat
gcccgggaaaatgaaatggatgaaaacctagagcaggtgagcggcatcatcggaaacctc
cgtcatatggccctagacatgggcaatgagattgacacccagaatcgccagattgacagg
atcatggagaaggctgactccaacaaaaccagaattgatgaagccaaccaacgtgcaaca
aagatgctgggaagtggttaa

DBGET integrated database retrieval system