KEGG   Rattus norvegicus (rat): 25017Help
Entry
25017             CDS       T01003                                 

Gene name
Myo5a, D, Dop, Myh12
Definition
(RefSeq) myosin VA
  KO
K10357  myosin V
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    25017 (Myo5a)
   04131 Membrane trafficking [BR:rno04131]
    25017 (Myo5a)
   03029 Mitochondrial biogenesis [BR:rno03029]
    25017 (Myo5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25017 (Myo5a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     25017 (Myo5a)
   mRNA cycle factors
    P-body specific factors
     25017 (Myo5a)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Myosins
    25017 (Myo5a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    25017 (Myo5a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     25017 (Myo5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head DIL IQ Csm1_N AAA_22 Myosin_N AAA_16
Motif
Other DBs
NCBI-GeneID: 25017
NCBI-ProteinID: NP_071514
RGD: 3143
Ensembl: ENSRNOG00000058866
UniProt: Q9QYF3
Position
8q24
AA seq 1828 aa AA seqDB search
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTSELP
HLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADSFHYTKQGGSPMIEGVD
DAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLIIF
CDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVGHVN
QALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEK
PRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAIS
PTSATSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGLQFRNSLHLLMETLNATTPHYVRC
IKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVL
GDRKQTCQNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGW
LLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATTIQKYWRMYVVRRKYKIRRAA
TIVLQSYLRGYLARNRYRKILREHKAVIIQKRVRGWLARTHYKRTMKAIIYLQCCFRRMM
AKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLMEKLTNLEGVYNSE
TEKLRNDVERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKSIEERADKYKQET
EQLVSNLKEENTLLKQEKETLNHLMVEQAKEMTETMERKLVEETKQLELDLNDERLRYQN
LLNEFSRLEERYDDLKEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDIAPRT
EEPTEKKVPLDMSLFLKLQKRVTELGQEKQLMQDELDRKEEQVLRSKAKGGERPQIRGAE
LGYESLKRQELESENKKLKNELNELRKALSEKSAPEVNAPGAPAYRVLMEQLTAVSEELD
VRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMKDKGEIAQAYIGLKETNR
LLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITR
LTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIP
RKGKDFQGMLEYKREDEQKLVKNLILELKPRGVAVNLISGLPAYILFMCVRHADYLDDDQ
KVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNE
HCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGVSGVKPTGLR
KRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIVGAITLNNLLLR
KDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAI
CSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQVRLRDRKDSPQLLMDAKHIFPV
TFPFNPSSLALETIQIPASLGLGFIARV
NT seq 5487 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtccgagctctacaccaagtttgccagggtttggatccctgatcctgaggaa
gtgtggaaatcggcagagttgctcaaggattataagcctggagataaagtgctcctgctt
caccttgaggaagggaaggatttggaataccgtctagatccaaagaccagcgagctccct
cacctacggaaccctgacatacttgttggagaaaatgacctcacagccctcagctacctt
cacgagcctgctgtgctgcacaatctccgcgtccgcttcatcgactccaaactcatttat
acgtattgtgggatagtcctggtagctataaatccctatgagcagctgcctatctatgga
gaagatatcattaatgcatacagtggccagaacatgggtgacatggaccctcacatcttt
gcagtagctgaagaggcctataaacaaatggcaagggacgaacgaaatcagtccatcatt
gtaagtggagagtcaggtgcagggaagacagtctcggctaagtatgccatgaggtacttc
gcaactgtaagtggctctgccagtgaggccaatgttgaggaaaaggtcttggcctccaac
cccatcatggagtcaattggaaatgctaaaacaaccaggaatgataatagcagccggttt
gggaaatatattgaaattggttttgacaagagatatcgaatcatcggtgccaatatgaga
acttaccttttagagaaatccagagtggtgttccaggcagaagaggagagaaactaccat
atcttctatcagctctgtgcttcggcaaagctacctgagtttaagatgctgcggttagga
aatgcagatagtttccattacacgaagcaaggaggcagccctatgatagaaggagtggac
gatgcgaaggagatggcacacaccaggcaggcctgcactctgctgggaattagtgaatct
taccaaatgggaatttttcggatacttgctggcattcttcacttaggcaatgttgggttt
gcgtctcgagattcagacagctgcacaatacctcccaagcacgagcctcttatcattttc
tgtgatcttatgggtgtggattatgaagagatgtgtcactggctctgccaccgaaagcta
gctaccgccacagagacgtacatcaagcccatctccaagctgcaggccacaaatgcccga
gacgctttagcaaagcatatctatgcaaagctctttaactggattgtcggccatgtcaat
caggctctccattcagctgtcaagcagcactctttcatcggcgtgctggacatttatgga
tttgaaacatttgagataaatagttttgaacagttctgcataaattatgcaaatgaaaag
ctacagcaacaattcaacatgcatgtcttcaaactggaacaggaggagtacatgaaggaa
caaattccatggacactcatagatttctatgataatcagccttgtatcaatcttatagaa
tctaaactgggtattctagatttgctggatgaggaatgtaagatgcctaaaggtaccgat
gacacatgggcccaaaaactatacaacacacatttgaacaaatgtgctctctttgagaag
ccccgcatgtcaaacaaagctttcatcatcaaacattttgctgacaaagtggagtaccag
tgtgaaggttttcttgaaaagaataaagacactgtttttgaagaacaaattaaagtcctt
aagtcaagcaagtttaagatgctaccagaactatttcaagatgacgagaaggccatcagt
cccacctctgccacttcctcaggacgcacacctctcacacgggtacctgtaaagcccacc
aagggtcgacctggccagactgccaaagagcacaagaagacagtgggacttcagtttcga
aactcccttcacctgcttatggaaacccttaacgccactactcctcactatgttcgctgt
attaagcccaatgatttcaagtttccattcacatttgatgagaagagagcagtacagcag
ctaagagcatgtggtgtcctggagaccatccggatcagcgcagcagggtttccctcaagg
tggacttatcaagagtttttcagccggtaccgggtcctaatgaagcaaaaggatgtgctg
ggagatagaaagcaaacatgccagaatgtattagagaaactgatactggacaaggataaa
taccagtttggtaagacaaagatcttttttcgtgctggtcaagtggcctatctagaaaaa
ttgagggctgacaaactgagggcggcctgcatccggatccagaagacgattcgtgggtgg
ctgctgaggaagagatacctgtgtatgcagagggcagccatcacagtgcagcgatacgtg
cgtggctatcaggctcgatgctatgctaagtttctgcgcagaaccaaggcagcaaccacc
attcagaagtactggcgcatgtatgtggtccgcaggaagtacaagattagacgagctgcc
accattgttcttcagtcttatttgagaggctacttggcaagaaataggtatcgcaagata
ctccgtgagcacaaagcagtcatcattcagaaacgtgtccgtggctggctggctcgtaca
cattataagaggaccatgaaagccatcatctaccttcaatgctgcttccggcggatgatg
gccaagcgtgagctgaagaaactcaaaattgaggctcgctctgtggaacgctacaagaag
ctccatattggcatggaaaacaagattatgcagctgcaacgcaaagtggatgagcagaat
aaagactacaaatgcctcatggagaaactgaccaatctagaaggagtatacaactctgag
actgaaaaactacgaaatgatgtagaacgtcttcagctaagcgaggaggaagctaaggtt
gccactgggagagtgcttagtctgcaggaagaaattgcaaaactccgaaaagacctggag
caaactcgatcggagaaaaagtccattgaagaacgagcagataaatacaaacaagaaact
gagcagctggtgtcaaacttgaaggaagaaaacactctgctgaagcaggaaaaggagacc
ctcaatcacctcatggtggagcaggctaaggagatgacagaaactatggagaggaagtta
gtagaagaaacaaaacaactggagctcgacctgaatgatgagaggctgaggtatcaaaac
ctcctgaatgagttcagtcgtctggaggagcgctatgacgacctcaaggaagagatgacc
ctgatgctgaatgtgcctaagccaggacacaagagaacagactctacccacagcagcaat
gagtctgaatacaccttcagctcagaatttgcagaaactgaagacattgcaccaaggaca
gaggagccaactgagaagaaggtgcctttggatatgtcattgttccttaagctccagaag
cgtgttacagagctgggacaggagaagcagttgatgcaggatgagctggaccgaaaggag
gagcaggtgttgcgcagcaaggcaaagggaggagaaagaccacagattagaggtgctgaa
ctgggatatgagtccctcaagcgtcaggaactggagtcagaaaacaaaaagctgaagaat
gagctgaatgagctacgcaaagccctgagtgagaagagtgcccccgaagtgaatgcgcca
ggcgcgcccgcttaccgcgtcctcatggagcagctgacggccgtgagcgaggagctcgat
gtccgcaaggaggaagtcctcattttaaggtctcagctggtgagccagaaagaagccatc
caacccaaggatgacaagaatacaatgacagattccacaatacttttggaagatgtacag
aaaatgaaagacaaaggtgaaatagcacaagcatatattggtttgaaagaaacgaacagg
ctcttagaatcccagctacagtcgcagaagaggagccatgaaaatgaggctgaggccctc
cgtggggagatccagagcctaaaggaagaaaacaaccggcaacagcagctgctggcccag
aacctgcagctgccccctgaggcccgcattgaggccagcctgcagcatgagatcacccgg
ctgaccaatgaaaacctggatctgatggaacaacttgaaaagcaggataaaaccgtccgg
aaactgaagaaacaactaaaagtctttgccaaaaaaatcggtgaactagaagtggggcag
atggagaacatatccccaggacagatcatcgatgagcctatccggccggtcaacattccc
cggaaaggaaaggatttccaagggatgctggagtacaagcgggaggacgaacagaagctt
gttaagaacctgattctagaactaaagccacgtggtgtggctgtcaatctgatttcaggg
ttaccggcatatatcttgtttatgtgtgtgcgacatgccgactacctggacgatgatcag
aaagtaagatcattgctgacatcaacaattaacagcatcaaaaaagtcctgaagaaaaga
ggtgacgattttgaaactgtctccttctggctctctaacacatgtcgatttttgcactgt
ttgaagcaatatagtggagaagagggcttcatgaaacacaacacgtctcgccagaatgaa
cactgcctcaccaattttgaccttgctgagtatcggcaagtactgagtgacttggccatt
cagatctatcagcagcttgtgagggtgttagagaacattcttcagccaatgatagtctca
ggcatgctagagcatgaaacaattcagggagtatctggggtgaagcccacaggactcaga
aagcgaacctccagtatcgccgatgagggcacctacacactggactccatcctgcggcag
ctcaactccttccattccgtcatgtgtcagcatggcatggacccagagctaatcaagcag
gtggtcaagcagatgttctacatcgtgggcgccatcaccctgaacaacctcctgctgcgc
aaggacatgtgctcctggagcaaaggcatgcagatcaggtacaatgtcagtcaattggaa
gaatggctacgtgacaagaatctaatgaacagtggggcaaaagagactctggaacctctt
atccaggctgctcagcttttgcaagtgaaaaagaaaactgacgatgacgcggaagccatc
tgctccatgtgcaacgctctgaccacagcccagattgtcaaagtgttgaatctgtacaca
cccgttaatgagtttgaggaaagggtctctgtttcatttatccgcactatacaggtgcgg
ttacgagacaggaaagactctccacagctgctcatggatgcaaaacacatctttcctgtc
actttcccctttaacccatcctccctggccctagaaaccatccagattccagccagcctg
ggcctgggcttcattgcaagggtctga

DBGET integrated database retrieval system