KEGG   Rattus norvegicus (rat): 25024Help
Entry
25024             CDS       T01003                                 

Gene name
Gipr, Gippr, RATGIPPR
Definition
(RefSeq) gastric inhibitory polypeptide receptor
  KO
K04580  gastric inhibitory polypeptide receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25024 (Gipr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25024 (Gipr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25024 (Gipr)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Gut peptide
   Gastric inhibitory peptide (GIP)
    25024 (Gipr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 25024
NCBI-ProteinID: NP_036846
RGD: 2689
Ensembl: ENSRNOG00000015860
UniProt: P43219
Position
1q21
AA seq 455 aa AA seqDB search
MPLRLLLLLLWLWGLSLQRAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNG
SFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEK
NGAFQDQKLILERLQVVYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHMNLFTSFMLR
AGAILTRDQLLPPLGPYTGNQTPTLWNQALAACRTAQILTQYCVGANYTWLLVEGVYLHH
LLVVVRRSEKGHFRCYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPI
LITILINFLIFIRILGILVSKLRTRQMRCPDYRLRLARSTLTLMPLLGVHEVVFAPVTEE
QAEGSLRFAKLAFEIFLSSFQGFLVSVLYCFINKEVQSEIRRLRLSLQEQCPRPHLGQAP
RAVPLSSAPQEAAIRNALPSGMLHVPGDEVLESYC
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcggctgttgcttctgctgctgtggctctggggattgtcactccagagggcg
gagacagattctgaggggcagacgacgggagagctgtaccagcgctgggagcgttacggc
tgggaatgccaaaacaccttggaggccacagaacctccctcaggcctggcctgtaatggt
tccttcgatatgtatgcctgctggaactacacggctgccaacaccactgcccgggtgtcc
tgcccctggtatctgccctggtaccgccaggtggctgcaggcttcgtcttccgccagtgt
ggtagtgatggccaatggggatcttggagagaccacactcaatgtgagaatccagagaag
aatggggcctttcaggaccagaagctgatcttggagcgcctgcaggtcgtgtatacagtc
ggctactccctgtccctggccactctgctgctagccctactcattttaagtttgttcagg
cggcttcactgcactcgtaattacattcacatgaacctgttcacgtctttcatgctgcga
gcaggggccatcctcacccgagaccagctgctgcctccactgggtccctacacgggaaac
cagacccctaccctgtggaaccaggccctagctgcctgccgcacagcccagatcttgacc
cagtactgtgtgggagccaattacacctggctgctggtggagggtgtgtatctgcaccat
ctgctggtggttgtgagacgctcagaaaagggccacttccgctgctacctgcttcttggc
tggggggcccccgcgcttttcgtcatcccctgggtgatcgtcaggtacctgtacgagaac
acgcagtgctgggagcgcaacgaagtcaaagccatttggtggatcattcgcacccccatc
ctaataaccatcttgatcaatttcctcatctttatccgcatccttggcatccttgtttca
aagctgaggactcgacagatgcgctgtcccgactaccgactaaggctggctcgctccacg
ctgacactgatgcccctgctgggtgtccacgaggtggtatttgctcccgtgaccgaggaa
caggctgaaggctccctgcgctttgccaaactggcctttgaaatcttcttaagttccttc
cagggtttcctcgtgagtgtgctctactgcttcatcaacaaagaggtacagtcggagatc
cgccgtctgcgtctcagccttcaggaacagtgtccacgtccgcacctggggcaggccccc
cgggcggtgcctttgagctctgcaccccaggaagctgccatccgcaatgccttgccctct
gggatgctgcatgtgcctggagatgaggtcttggaaagttactgctag

DBGET integrated database retrieval system