KEGG   Rattus norvegicus (rat): 25029
Entry
25029             CDS       T01003                                 

Gene name
Calcrl, CLR, Crlr, RATCRLR, RNCLR
Definition
(RefSeq) calcitonin receptor like receptor
  KO
K04577  calcitonin receptor-like
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25029 (Calcrl)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25029 (Calcrl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25029 (Calcrl)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    25029 (Calcrl)
SSDB
Motif
Pfam: 7tm_2 HRM DUF4034
Other DBs
NCBI-GeneID: 25029
NCBI-ProteinID: NP_036849
RGD: 2255
Ensembl: ENSRNOG00000054695
UniProt: Q63118
Position
3q24
AA seq 464 aa
MMDKKCTLCFLFLLLLNMALIAAESEEGANQTDLGVTRNKIMTAQYECYQKIMQDPIQQG
EGLYCNRTWDGWLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQDGNWFRHPDSNRT
WTNYTLCNNSTHEKVKTALNLFYLTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNL
FFSFVCNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLLPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKV
AEEVYDYVMHILMHYQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSAS
YTVSTISDVQGYSHDCPTEHLNGKSIQDIENVALKPEKMYDLVM
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatggataaaaagtgtacactatgttttctgtttctcttgcttcttaatatggctctc
atcgcagcagagtcggaagaaggcgcgaaccaaacagacttgggagtcactaggaacaag
atcatgacggctcagtatgaatgttaccaaaagatcatgcaggatcccattcaacaagga
gaaggcctttactgcaacagaacctgggacggatggctatgctggaatgacgttgcagca
ggaaccgagtcaatgcagtactgccctgattactttcaagattttgatccttcagagaag
gttacaaagatctgtgaccaagatggaaactggttcagacatccagatagtaacaggaca
tggacaaactacaccttgtgtaacaacagcacgcatgagaaagtgaagacagcactgaat
ttgttctacctaactataattggacatggattatctattgcctctctgatcatctcactc
atcatatttttttatttcaagagcctaagttgccaacggattacattgcataaaaacctg
ttcttttcatttgtttgtaattcgattgtgacaatcattcacctcacggcagtggccaat
aaccaggccttagtggccacaaatcctgtgagctgcaaggtgtcccagttcattcatctt
tacctgatgggctgtaactacttttggatgctctgtgaaggcatttacctgcacacactc
attgtggtggctgtgtttgcagagaagcagcacttgatgtggtattattttcttggctgg
gggtttcctctgcttcctgcctgcatccatgccatcgccagaagcttgtattacaatgac
aactgctggatcagctcagacactcatctcctctacatcatccatggtcccatttgtgct
gctttactggtaaatctctttttcctattaaatattgtacgtgttctcatcaccaagttg
aaagttacacaccaagcagaatccaatctctacatgaaagctgtaagagccactctcatc
ttggtaccactacttggcattgaatttgtgctttttccatggcggcctgaaggaaaggtt
gctgaggaggtgtatgactatgtcatgcacattctcatgcactatcagggtcttttggtg
tctacaattttctgcttctttaacggagaggttcaagcaattctgagaagaaattggaac
cagtataaaatccaatttggcaatggcttttcccactctgatgctctccgcagcgcatcc
tatacggtgtcaacaatcagcgatgtgcaggggtacagccacgactgccccactgaacac
ttaaatggaaaaagcatccaggatattgaaaatgttgccttaaaaccagaaaaaatgtat
gatctagtgatgtga

DBGET integrated database retrieval system