KEGG   Rattus norvegicus (rat): 25031Help
Entry
25031             CDS       T01003                                 

Gene name
Plcb4, Beta4aa, RATBETA4AA
Definition
(RefSeq) phospholipase C, beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04621  NOD-like receptor signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing's syndrome
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno05010  Alzheimer's disease
rno05016  Huntington's disease
rno05142  Chagas disease (American trypanosomiasis)
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05200  Pathways in cancer
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    25031 (Plcb4)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    25031 (Plcb4)
   04310 Wnt signaling pathway
    25031 (Plcb4)
   04371 Apelin signaling pathway
    25031 (Plcb4)
   04020 Calcium signaling pathway
    25031 (Plcb4)
   04070 Phosphatidylinositol signaling system
    25031 (Plcb4)
   04072 Phospholipase D signaling pathway
    25031 (Plcb4)
   04071 Sphingolipid signaling pathway
    25031 (Plcb4)
   04022 cGMP - PKG signaling pathway
    25031 (Plcb4)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    25031 (Plcb4)
 Organismal Systems
  Immune system
   04611 Platelet activation
    25031 (Plcb4)
   04621 NOD-like receptor signaling pathway
    25031 (Plcb4)
   04062 Chemokine signaling pathway
    25031 (Plcb4)
  Endocrine system
   04911 Insulin secretion
    25031 (Plcb4)
   04922 Glucagon signaling pathway
    25031 (Plcb4)
   04912 GnRH signaling pathway
    25031 (Plcb4)
   04915 Estrogen signaling pathway
    25031 (Plcb4)
   04921 Oxytocin signaling pathway
    25031 (Plcb4)
   04926 Relaxin signaling pathway
    25031 (Plcb4)
   04918 Thyroid hormone synthesis
    25031 (Plcb4)
   04919 Thyroid hormone signaling pathway
    25031 (Plcb4)
   04928 Parathyroid hormone synthesis, secretion and action
    25031 (Plcb4)
   04916 Melanogenesis
    25031 (Plcb4)
   04924 Renin secretion
    25031 (Plcb4)
   04925 Aldosterone synthesis and secretion
    25031 (Plcb4)
   04927 Cortisol synthesis and secretion
    25031 (Plcb4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25031 (Plcb4)
   04270 Vascular smooth muscle contraction
    25031 (Plcb4)
  Digestive system
   04970 Salivary secretion
    25031 (Plcb4)
   04971 Gastric acid secretion
    25031 (Plcb4)
   04972 Pancreatic secretion
    25031 (Plcb4)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    25031 (Plcb4)
  Nervous system
   04724 Glutamatergic synapse
    25031 (Plcb4)
   04725 Cholinergic synapse
    25031 (Plcb4)
   04728 Dopaminergic synapse
    25031 (Plcb4)
   04726 Serotonergic synapse
    25031 (Plcb4)
   04720 Long-term potentiation
    25031 (Plcb4)
   04730 Long-term depression
    25031 (Plcb4)
   04723 Retrograde endocannabinoid signaling
    25031 (Plcb4)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25031 (Plcb4)
  Environmental adaptation
   04713 Circadian entrainment
    25031 (Plcb4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25031 (Plcb4)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    25031 (Plcb4)
   05016 Huntington's disease
    25031 (Plcb4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    25031 (Plcb4)
   04934 Cushing's syndrome
    25031 (Plcb4)
  Infectious diseases
   05146 Amoebiasis
    25031 (Plcb4)
   05142 Chagas disease (American trypanosomiasis)
    25031 (Plcb4)
   05143 African trypanosomiasis
    25031 (Plcb4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     25031 (Plcb4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    25031 (Plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    25031 (Plcb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 25031
NCBI-ProteinID: NP_077329
RGD: 3345
Ensembl: ENSRNOG00000033119
UniProt: Q9QW07
Position
3q36
AA seq 1176 aa AA seqDB search
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRLAAIPKDPKILAALESVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPE
ITKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTSGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYQM
SKYCEDLFGDLLLKQALESHPLEPGRLLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPASILEDDNEEEIESAADQEEEAHPEYKFGNELSADDFSHKEAVANSVKKGL
VTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESV
GLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQ
LNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIG
TYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNN
KLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGLGDIVDALSDPK
KFLSITEKRADQLRAMGIETSDIADVPSDTSKNDKKGKANPAKANVTPQSSSELRPTTTA
ALGSGQEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCT
QVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEIKKETEIKIQTLTSDHKSKVKEIVAQ
HTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAH
QAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKV
QLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccttacgaatttaactggcagaaggaggtaccctctttcttgcaagaagga
gcagtttttgacagatatgaagaggaatctttcgtgtttgagcccaactgcctcttcaaa
gtggatgaattcggcttcttcctgacctggaagagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagcattcggctggcagccataccaaaggatcccaaaatcctg
gctgctctcgagtctgttggaaaatctgaaaatgatctggaagggcggatattgtgtgtc
tgcagcggcacggatctggtgaatattggcttcacttacatggtggctgaaaacccagaa
ataactaagcaatgggtagaaggcctgagatcaatcattcacaacttcagggcaaacaac
gtcagtccgatgacatgcctcaagaaacactggatgaaactggcctttctgaccaacaca
agtggcaaaatcccagtgaggagtattactagaaccttcgcatcagggaaaacagaaaag
gtgatctttcaagcactcaaggaattaggtctccccagtggaaagaatgatgaaattgaa
cctgctgcatttacctatgaaaagttctatgaactgacacagaagatttgtcctcggaca
gatatagaagatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaacgaacatcagcgagatcctcggctgaatgaaattttattc
ccgttttatgatgctaaaagagcaatgcagatcattgagatgtatgaacctgatgaagag
ttgaagaaaaaaggcctcatatccagtgatggattctgcagatatctcatgtcagatgaa
aatgcccccgtcttcctagatcgcttagaactttaccaggagatggaccaccccctggcc
cattacttcatcagttcctctcacaacacctatctcaccggccggcagtttggcggaaag
tcttcagtggaaatgtaccgacaagtcctcctggctggttgcaggtgtgtggaacttgac
tgttgggatggaaaaggtgaagatcaggaaccaataataactcacggaaaagcaatgtgt
acagacatcctttttaaggatgtaatccaggccatcaaggaaacagcgtttgtcacatca
gaatatcctgtaattctctcctttgaaaaccactgcagcaaatatcaacagtaccagatg
tccaagtattgtgaagatctatttggggatcttctgttgaaacaagcacttgagtcacat
ccacttgaaccagggaggctcttgccatctcctaatgacctcaaaagaaaaatactcatc
aaaaataaaaggctgaagcctgaagttgaaaaaaaacagctggaggctttgaaaagcatg
atggaggctggagaatcagctgccccggccagcatcttggaagatgacaatgaggaggaa
atagaaagcgcagctgatcaagaggaagaagcccaccctgaatacaagtttggaaatgaa
ctttctgccgatgacttcagtcacaaggaagcggttgcaaacagcgtcaagaagggcctg
gtcaccgtagaagatgagcaggcatggatggcatcttataaatacgtaggtgctaccacg
aatatccatccgtacttgtccacgatgatcaactatgcacagcctgtgaagtttcaaggt
ttccatgtggctgaagagcgcaacattcattataacatgtcttcttttaacgagtcggtt
ggccttggctacttgaagacgcacgcgattgagtttgtaaattacaataagcgacaaatg
agccgcatttaccccaagggagggcgagttgattccagtaattacatgcctcagattttc
tggaacgctggttgccagatggtttcactgaactatcaaaccccagatttagcgatgcaa
ttgaatcaaggaaaatttgagtataacggatcctgcggatacctcctcaagccagacttc
atgagacggcctgatcggacatttgatcccttctctgaaacccctgtggacggggttatt
gcagccacatgctcagtgcaggttatatcagggcagttcctgtcagataagaagatcggc
acatacgtggaagtcgatatgtacgggctgcccaccgacaccatacggaaggagttccga
acccgcatggttatgaacaatggactcaacccagtttacaatgaagaatcgttcgtgttt
cggaaggtgatcctgcctgacctggctgtcctgagaatcgctgtgtacgacgacaacaac
aagctcattggccagaggatccttcctctggatggcctccaggcaggttaccgacacatc
tccctgagaaatgagggaaacaaaccgttatcactgccaacaattttctgcaatatcgtt
cttaaaacatatgtgcctgatggattgggagatattgtggatgctctatccgatccaaag
aaattcctttcaatcacagagaagagagcagaccaattgagagcaatgggcattgaaact
agtgacatagcagatgtgcccagtgacacttccaaaaatgacaagaaaggcaaggccaac
ccagccaaagcgaatgtaacccctcagagcagctctgagctcagaccaaccaccacagct
gccctgggatctggccaggaagccaagaaaggtattgaacttatccctcaagtgaggata
gaagatttaaagcaaatgaaggcttacttgaagcatttaaagaaacaacaaaaggagtta
aactctttaaagaagaaacacgcaaaggagcacagtaccatgcagaagttacactgcaca
caagtggacaaaatcgtggcccagtatgacaaggagaagtcgactcatgagaaaatccta
gagaaggccatgaagaagaaggggggaagtaattgccttgaaataaaaaaagaaacagaa
attaagattcagaccctgacatcggatcacaaatctaaggtcaaggagattgtggcgcag
cacacaaaggagtggtcagaaatgatcaacacgcacagcgccgaggagcaggaaatccgg
gacctgcacctgagccagcagtgtgagctgctgaggaagctgctcatcaacgctcatgag
cagcagacccagcagctgaagctctcccatgacagggaaagcaaagagatgcgagcccat
caggctaagatttctatggaaaatagcaaagccatcagtcaagataaatctatcaagaat
aaggcagaacgggagaggcgagtcagggagttgaacagcagcaacactaagaagtttcta
gaagaaagaaagagactggcaatgaagcagtcgaaagaaatggatcagctgaaaaaggtc
cagctggagcacctagaattcctagagaaacagaatgagcaggcgaaggagatgcagcag
atggtgaaattggaagccgagatggaccgcagaccagcaacagtagtatga

DBGET integrated database retrieval system