KEGG   Rattus norvegicus (rat): 25033Help
Entry
25033             CDS       T01003                                 

Gene name
Sstr1, Gpcrrna
Definition
(RefSeq) somatostatin receptor 1
  KO
K04217  somatostatin receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25033 (Sstr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25033 (Sstr1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    25033 (Sstr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25033 (Sstr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Somatostatin
    25033 (Sstr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 T2SSM Piezo_RRas_bdg
Motif
Other DBs
NCBI-GeneID: 25033
NCBI-ProteinID: NP_036851
RGD: 3762
Ensembl: ENSRNOG00000048145
UniProt: P28646
Position
6q23
AA seq 391 aa AA seqDB search
MFPNGTAPSPTSSPSSSPGGCGEGVCSRGPGSGAADGMEEPGRNSSQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCASRISTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaatggcaccgccccctctcccacctcttctcccagctccagcccaggcggc
tgcggggaaggagtctgcagcaggggtcccgggtccggcgctgcggacggcatggaagaa
cctggacgaaactcttcccagaacgggactttaagcgagggtcagggtagcgccattctc
atctctttcatctactccgtggtatgcttggtgggactgtgtgggaactccatggtcatt
tacgtgatcctgcgctacgccaagatgaagaccgcaaccaacatctacattctaaacctg
gccattgctgatgagctgctcatgctcagcgtgccctttctggtcacttccacgctgttg
cgccactggccctttggcgcgctactttgccgcctggtgctcagcgtggatgcagtcaac
atgttcaccagcatctactgtctgactgtgcttagtgtggaccgctatgtggctgtggtg
cacccgatcaaggcagcgcgctaccgtcggcccactgtggccaaagtagtgaacctgggc
gtgtgggtgctgtcgctactggttatcttgcccatcgtggtcttctcacgcaccgcagcc
aacagcgatggcacggtggcctgcaacatgctcatgcccgagcccgcccagcgctggttg
gtgggcttcgtcttatacacatttctcatgggcttcctgctgcctgtcggggccatctgc
ctgtgttacgtgctcatcattgccaagatgcgcatggtggccctcaaggccggctggcag
cagcgcaagcgctcagagcgcaagatcactctaatggtgatgatggtggtgatggttttt
gtcatctgctggatgcctttctacgtggtacagctagtcaacgtgttcgccgagcaagac
gacgccacggtgagccagttgtctgtcatcctcggctatgccaatagctgtgccaacccc
atcctctacggcttcctgtcggacaacttcaagcgctctttccagcgcatcctgtgcctc
agctggatggataacgctgcggaggagcctgttgactactacgccactgccctgaagagt
cgtgcctacagtgtggaggacttccagcctgagaatctggaatctggaggcgttttccgt
aatggcacctgcgcttccaggatcagcacgctttga

DBGET integrated database retrieval system