KEGG   Rattus norvegicus (rat): 25035
Entry
25035             CDS       T01003                                 

Symbol
Cyb5r3
Name
(RefSeq) NADH-cytochrome b5 reductase 3
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    25035 (Cyb5r3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     25035 (Cyb5r3)
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Other DBs
NCBI-GeneID: 25035
NCBI-ProteinID: NP_620232
RGD: 2502
Ensembl: ENSRNOG00000009592
UniProt: P20070
Structure
PDB: 
1QX4 1I7P 1IB0

Position
7
AA seq 301 aa
MGAQLSTLSRVVLSPVWFVYSLFMKLFQRSSPAITLENPDIKYPLRLIDKEIISHDTRRF
RFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPK
FPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAG
GTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVD
KAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFT
F
NT seq 906 nt   +upstreamnt  +downstreamnt
atgggggcccagctgagcacgttgagccgagtggtactctccccggtctggttcgtctac
agcctcttcatgaagctgtttcagcgctcctcaccggccatcaccctcgagaaccccgac
atcaagtaccctctgcggctcatcgacaaggagattatcagccacgacactcggcgcttc
cgatttgcactcccttcgccccagcacatcctgggccttcctatcggccagcacatctac
ctctccaccaggatcgatggcaacttggtcattcgtccctacacccctgtgtctagtgat
gatgacaagggctttgtggacttggtggtcaaggtttacttcaaggacacgcatcccaag
tttccagctggagggaaaatgtctcagtacctggaaaacatgaatattggagacaccatt
gaattccggggccccaatgggctactggtctaccagggcaaagggaagttcgccatccgt
gcagacaagaagtccaaccctgttgtcaggacggtgaagtctgtaggcatgattgcagga
gggacaggcatcaccccaatgctgcaggtgatccgagccgtcttgaaggacccgaacgac
cacactgtgtgctatctgctcttcgccaaccagtccgagaaagacatcctgctgcggcct
gagctggaggaactgaggaacgaacattcttctcgcttcaagctctggtacacagtggac
aaagcccccgatgcctgggactatagccaaggcttcgtgaatgaggagatgatcagggac
catcttccacctcctggggaggagacactgatactgatgtgtggacccccaccgatgatc
cagtttgcctgtttgccaaacctggagcgtgtgggccatcccaaggagcgatgcttcacc
ttctga

DBGET integrated database retrieval system