KEGG   Rattus norvegicus (rat): 25037Help
Entry
25037             CDS       T01003                                 

Gene name
Mobp, Mobp81, Mobp81p
Definition
(RefSeq) myelin-associated oligodendrocyte basic protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE_2
Motif
Other DBs
NCBI-GeneID: 25037
NCBI-ProteinID: NP_036852
RGD: 3101
Ensembl: ENSRNOG00000018700
UniProt: Q63327
Position
8q32
AA seq 81 aa AA seqDB search
MSQKVAKEGPRLSKNQKFSEHFSIHCCPPFTFLNSKREIVDRKYSICKSGCFYQKKEEDW
ICCACQKTRLRRRSRSTPRKK
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaagtggccaaggagggccccaggctctccaagaaccagaagttctcagag
cacttcagcatccactgctgcccacccttcaccttcctcaactccaagcgtgagatcgtg
gaccgcaagtacagcatctgcaagagcggttgcttttaccagaagaaggaggaggactgg
atctgctgtgcctgccagaagaccagattgagaaggaggagcaggtcaaccccaagaaaa
aagtga

DBGET integrated database retrieval system