KEGG   Rattus norvegicus (rat): 25040
Entry
25040             CDS       T01003                                 

Gene name
Gip
Definition
(RefSeq) gastric inhibitory polypeptide precursor
  KO
K05258  gastric inhibitory polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25040 (Gip)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25040 (Gip)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25040 (Gip)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 25040
NCBI-ProteinID: NP_062604
RGD: 2709
Ensembl: ENSRNOG00000006306
UniProt: Q06145
Position
10
AA seq 144 aa
MVALKTCSLLLVLLFLAVGLGEKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKI
RQQDFVNWLLAQKGKKNDWKHNLTQREARALELAGQSQRNEEKEAQGSSLPKSLSDEDVL
RDLLIQELLAWMADQAELCRLRSQ
NT seq 435 nt   +upstreamnt  +downstreamnt
atggtggctttgaagacctgctctctgctgctggtgctcctgttcctggctgtcgggctg
ggagaaaaagaagaggttgagttccgatcccatgctaaatttgctggcccccgaccacga
ggcccaaggtatgcagaggggactttcatcagtgattacagcatcgccatggacaagatc
cgccaacaagactttgtgaactggcttctggcccagaaggggaagaagaatgactggaaa
cacaacctcacccagagagaggcccgggctttggagctggcaggacaatctcagagaaac
gaggagaaagaggcacaggggagctctttgcccaagagcctcagtgatgaagatgtgctg
agggaccttctgattcaagagctactggcctggatggcggaccaagcagagctctgtcga
ctgaggtcccagtga

DBGET integrated database retrieval system