KEGG   Rattus norvegicus (rat): 25041
Entry
25041             CDS       T01003                                 

Gene name
P2rx6, P2rxl1, P2x6, Rnap2x6
Definition
(RefSeq) purinergic receptor P2X 6
  KO
K05221  P2X purinoceptor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25041 (P2rx6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25041 (P2rx6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25041 (P2rx6)
Ion channels [BR:rno04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   25041 (P2rx6)
SSDB
Motif
Pfam: P2X_receptor Spec3 Dickkopf_N WAP
Other DBs
NCBI-GeneID: 25041
NCBI-ProteinID: NP_036853
RGD: 3243
Ensembl: ENSRNOG00000001873
UniProt: P51579
Position
11q23
AA seq 389 aa
MQLQPAGTGSMASAVAAALVSWGFLDYKTEKYVMTRNCWVGISQRLLQLGVVVYVIGWAL
LAKKGYQEWDMDPQISVITKLKGVSVTQVKELEKRLWDVADFVRPSQGENVFFLVTNFLV
TPAQVQGRCPEHPSVPLANCWADEDCPEGEMGTYSHGIKTGQCVAFNGTHRTCEIWSWCP
VESSAVPRKPLLAQAKNFTLFIKNTVTFNKFNFSRTNALDTWDNTYFKYCLYDSLSSPYC
PVFRIGDLVAMTGGDFEDLALLGGAVGINIHWDCNLDTKGSDCSPQYSFQLQERGYNFRT
ANYWWAASGVESRSLLKLYGIRFDILVTGQAGKFALIPTAITVGTGAAWLGMVTFLCDLL
LLYVDREAGFYWRTKYEEARAPKATTNSA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcagttgcagccagcgggaactgggagcatggcttctgcagtcgcagcagcactagtg
agctgggggtttctggattacaagacagagaaatatgtgatgaccaggaactgctgggtg
ggcatctcccagaggctgctgcagctcggagtggtagtctacgtgattgggtgggccctc
ttggccaaaaaaggctaccaggaatgggacatggacccccagatttctgtcatcaccaaa
ctcaagggggtttctgtaacccaggttaaggaactggagaaacggctgtgggatgtggct
gacttcgtgaggccatcacagggagagaatgtgttcttcctggtaaccaacttccttgtg
acaccagctcaagtccagggcagatgcccagagcatccttctgttcctctggctaactgc
tgggctgatgaggactgtcctgaaggggagatggggacatacagccacggcataaagact
ggtcagtgtgtggcgttcaacggaacccacaggacctgtgagatctggagctggtgccca
gtggagagtagtgctgtgcccaggaaacccctgctagctcaggccaagaacttcacgctc
ttcatcaaaaatactgtaaccttcaacaagttcaacttctccagaaccaatgccttagat
acctgggacaacacctatttcaagtactgtctctacgattcactctccagtccgtactgc
ccagtgttccgcatcggggaccttgtggctatgactggaggggactttgaggaccttgca
ttgctgggtggtgctgtgggcatcaacatccactgggattgcaacctggacacgaaaggc
tctgactgctctccccagtactccttccagctgcaggagagggggtacaatttcaggaca
gctaattactggtgggcagcctcaggcgtggagtcccggagcctgctcaaactctatggg
atccgctttgacattcttgtcactgggcaggcaggaaagtttgcactcatccctacggcc
atcacagtgggcacaggagcagcttggctgggcatggtcaccttcctctgtgatctgctg
ctactgtacgtggatagagaggccggtttctactggaggaccaagtatgaagaggcaaga
gccccaaaggcaactaccaacagtgcatag

DBGET integrated database retrieval system