KEGG   Rattus norvegicus (rat): 25044Help
Entry
25044             CDS       T01003                                 

Gene name
Sds, RATSDHE1, SDH2, Sdh, Sdhe1, TDH
Definition
(RefSeq) serine dehydratase
  KO
K17989  L-serine/L-threonine ammonia-lyase [EC:4.3.1.17 4.3.1.19]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00270  Cysteine and methionine metabolism
rno00290  Valine, leucine and isoleucine biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    25044 (Sds)
   00270 Cysteine and methionine metabolism
    25044 (Sds)
   00290 Valine, leucine and isoleucine biosynthesis
    25044 (Sds)
Enzymes [BR:rno01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     25044 (Sds)
    4.3.1.19  threonine ammonia-lyase
     25044 (Sds)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 25044
NCBI-ProteinID: NP_446414
RGD: 67376
Ensembl: ENSRNOG00000001388
UniProt: P09367
Structure
PDB: 

Position
12q16
AA seq 327 aa AA seqDB search
MAAQESLHVKTPLRDSMALSKVAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCKHF
VCSSAGNAGMATAYAARRLGLPATIVVPSTTPALTIERLKNEGATVEVVGEMLDEAIQLA
KALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGGGGLLCGVVQGL
REVGWEDVPIIAMETFGAHSFHAAVKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHP
IFSEVISDQEAVTAIEKFVDDEKILVEPACGAALAAVYSGVVCRLQAEGRLQTPLASLVV
IVCGGSNISLAQLQALKAQLGLNELLK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccaggagtccctgcacgtgaagaccccactacgtgacagcatggcattgtcc
aaagtggccggcactagtgtgttccttaagatggacagctctcagccctctggctccttc
aagatccgaggcattgggcatctctgcaagatgaaggcaaaacaaggctgtaaacatttc
gtctgctcttcagcgggcaacgcgggcatggcgactgcctatgctgccaggaggctgggc
ctcccagccactattgttgtgccaagcaccacacctgccctcaccattgagcggctgaag
aacgaaggggccacagttgaagtggtgggagagatgctggatgaggccatccaactggcc
aaggctctggaaaagaacaacccaggttgggtgtacatctcccccttcgatgaccctctc
atctgggaaggccacacttcccttgtgaaggagctgaaggagacactgagcgccaagccc
ggggccattgtgctgtctgtgggcggtggaggcctgctgtgcggagtggtccaggggctg
cgggaggtgggctgggaggatgtgcccatcatcgccatggagaccttcggcgcccacagc
ttccacgctgccgtcaaggaaggaaagctggtcaccctgcccaagatcaccagtgttgcc
aaggccttgggtgtgaacactgtgggggcacagaccctgaagctgttttacgaacacccc
attttctctgaggtcatctcagaccaggaggctgtgactgctatcgagaagttcgtagac
gatgagaagatcctggtggagcccgcgtgtggcgctgccctggctgcagtgtacagcggt
gtggtgtgcaggctgcaggctgagggccgactgcaaaccccactggcctcgctggttgtc
attgtgtgtggtggcagcaacatcagcctggcacagctgcaggcactcaaggcacagctg
ggcctgaatgagctactcaagtga

DBGET integrated database retrieval system