KEGG   Rattus norvegicus (rat): 25045Help
Entry
25045             CDS       T01003                                 

Gene name
Dbi, Acbp, Acoabp3, Ep, Odn, RNACOABP3, Ttn
Definition
(RefSeq) diazepam binding inhibitor, acyl-CoA binding protein
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    25045 (Dbi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACBP
Motif
Other DBs
NCBI-GeneID: 25045
NCBI-ProteinID: NP_114054
RGD: 2490
Ensembl: ENSRNOG00000046889
UniProt: P11030
Position
13q11
AA seq 87 aa AA seqDB search
MSQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWN
KLKGTSKENAMKTYVEKVEELKKKYGI
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggctgatttcgacaaagccgctgaggaggtgaagcgcctcaagactcagcca
actgatgaagagatgctgttcatctacagccacttcaaacaagctactgtgggcgatgta
aacacagatcggccggggctgttggacctcaagggcaaagccaagtgggactcgtggaac
aagctgaaaggaacttccaaggaaaatgccatgaagacctatgtggaaaaggtagaagag
ctaaagaagaaatatggaatataa

DBGET integrated database retrieval system