KEGG   Rattus norvegicus (rat): 25048
Entry
25048             CDS       T01003                                 

Gene name
Klkb1, KALP15, Kalp1, Klk3, PK
Definition
(RefSeq) kallikrein B1
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25048 (Klkb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25048 (Klkb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     25048 (Klkb1)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   25048 (Klkb1)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 DUF1986 Trypsin_2 PAN_2
Other DBs
NCBI-GeneID: 25048
NCBI-ProteinID: NP_036857
RGD: 67382
Ensembl: ENSRNOG00000014118
UniProt: Q5FVS2
Position
16q11
AA seq 638 aa
MILFKQVGYFVSLFATVSCGCLSQLYANTFFRGGDLAAIYTPDAQHCQKMCTFHPRCLLF
SFLAVSPTKETDKRFGCFMKESITGTLPRIHRTGAISGHSLKQCGHQLSACHQDIYEGLD
MRGSNFNISKTDSIEECQKLCTNNIHCQFFTYATKAFHRPEYRKSCLLKRSSSGTPTSIK
PVDNLVSGFSLKSCALSEIGCPMDIFQHFAFADLNVSHVVTPDAFVCRTVCTFHPNCLFF
TFYTNEWETESQRNVCFLKTSKSGRPSPPIIQENAVSGYSLFTCRKARPEPCHFKIYSGV
AFEGEELNATFVQGADACQETCTKTIRCQFFTYSLLPQDCKAEGCKCSLRLSTDGSPTRI
TYEAQGSSGYSLRLCKVVESSDCTTKINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCG
GSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEG
SYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATI
PLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGE
GCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgattttattcaaacaagtgggttattttgtttccttgttcgctacagtttcctgtggg
tgtctgtcacaactgtatgcaaataccttcttcagaggtggggatctggctgccatctac
accccggatgcccagcactgtcagaagatgtgcacgtttcaccccaggtgcctgctcttc
agcttccttgccgtgagtccaaccaaggagacagataaaaggtttgggtgcttcatgaaa
gagagcattacagggactttgccaagaatacaccggacaggggccatttctggtcattct
ttaaaacagtgtggccatcaattaagtgcttgccaccaagacatatacgaaggactggat
atgagagggtccaactttaatatatctaagaccgacagtattgaagaatgccagaaactg
tgcacaaataatattcactgccaatttttcacatatgctacaaaagcatttcacagacca
gagtacaggaagagttgcctgctgaagcgcagttcaagtggaacgcccaccagtataaag
ccagtggacaacctggtgtctggattctcactgaagtcctgtgctctctcagagatcggt
tgccccatggatattttccagcactttgcctttgcagacctgaatgtaagccatgtcgtc
acccccgatgccttcgtgtgtcgcaccgtttgcaccttccatcccaactgcctcttcttc
acattctacacgaatgagtgggagacggaatcacagaggaatgtttgttttcttaagaca
tctaaaagtggaagaccaagtccccctattattcaagaaaatgctgtatctggatacagt
ctcttcacctgcagaaaagctcgccctgaaccctgccatttcaagatttactctggagtt
gccttcgaaggggaagaactgaacgcgaccttcgtgcagggagcagatgcgtgccaagag
acttgtacaaagaccatccgctgtcagttttttacttactcattgcttccccaagactgc
aaggcagaggggtgtaaatgttccttaaggttatccacggatggctctccaactaggatc
acctatgaggcacaggggagctctggttattctctgagactgtgtaaagttgtggagagc
tctgactgtacgacaaaaataaatgcacgtattgtgggaggaacaaactcttctttagga
gagtggccatggcaggtcagcctgcaagtaaagttggtttctcagaatcatatgtgtgga
gggtccatcattggacgccaatggatactgacggctgcccattgctttgatgggattccc
tatccagacgtgtggcgtatatatggcgggattcttaatctgtcagagattacaaacaaa
acgcctttctcaagtataaaggagcttattattcatcagaaatacaaaatgtcagaaggc
agttacgatattgccttaataaagcttcagacaccgttgaattatactgaattccaaaaa
ccaatatgcctgccttccaaagctgacacaaatacaatttataccaactgctgggtgact
ggatggggctacacaaaggaacgaggtgagacccaaaatattctacaaaaggcaactatt
cccttggtaccaaatgaagaatgccagaaaaaatatagagattatgttataaccaagcag
atgatctgtgctggctacaaagaaggtggaatagatgcttgtaagggagattccggtggc
cccttagtttgcaaacatagtggaaggtggcagttggtgggtatcaccagctggggcgaa
ggctgtgcccgcaaggagcaaccaggagtctacaccaaagttgctgagtacattgactgg
atattggagaagatacagagcagcaaggaaagagctctggagacatctccagcatga

DBGET integrated database retrieval system