KEGG   Rattus norvegicus (rat): 25051
Entry
25051             CDS       T01003                                 

Gene name
Glp1r, Glip, RATGL1RCP
Definition
(RefSeq) glucagon-like peptide 1 receptor
  KO
K04581  glucagon-like peptide 1 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25051 (Glp1r)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25051 (Glp1r)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25051 (Glp1r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25051 (Glp1r)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Pancreatic peptide
   Glucagon
    25051 (Glp1r)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 25051
NCBI-ProteinID: NP_036860
RGD: 2703
Ensembl: ENSRNOG00000001152
UniProt: P32301
Position
20p12
AA seq 463 aa
MAVTPSLLRLALLLLGAVGRAGPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGL
FCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPW
RDLSECEESKQGERNSPEEQLLSLYIIYTVGYALSFSALVIASAILVSFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLVFIRVICIVIAKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFVKLFTELSFTSFQGFMVAVLYCFVNNEVQMEFRKSWERW
RLERLNIQRDSSMKPLKCPTSSVSSGATVGSSVYAATCQNSCS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggccgtcacccccagcctgctgcgcctggcgctcctgctgctcggggcggtgggcagg
gccggcccccgcccccagggtgccacggtgtccctctcagagacagtgcagaaatggaga
gagtatcggcaccagtgccaacgtttcctcacggaagcgccactcctggccacaggtctc
ttctgcaaccgaacctttgatgactacgcctgctggccagatgggcccccaggttccttt
gtgaatgtcagttgcccctggtacctgccgtgggccagtagtgtgctccaagggcatgtg
taccggttctgcacggccgagggtatctggctgcataaggacaactccagcctgccctgg
agggacctgtcggagtgcgaagagtccaagcaaggagagagaaactcccctgaggaacag
ctcctgtcgctgtacattatctacacggtggggtacgcactttctttctctgccttggtc
atcgcttcagccatccttgtcagcttcagacacttgcactgcaccaggaactacatccac
ctgaacctgtttgcgtccttcatcctccgagcactgtccgtcttcatcaaagacgctgcc
ctcaagtggatgtatagcacggctgcgcaacagcaccagtgggatgggctcctctcgtat
caggactctctgggctgccgactggtgttcctgctcatgcaatactgcgtggcggccaac
tactactggttgctggtggaaggcgtgtatctgtacacactgctggccttctcggtgttc
tcggagcagcgcatcttcaagctgtacctgagcataggctggggagttccgctgctgttc
gttatcccctggggcattgtcaagtatctctacgaggacgagggttgctggaccaggaac
tccaacatgaactattggctcatcatacgcttgcccattctctttgcaatcggggtcaac
ttccttgtcttcatccgggtcatctgcatcgtgatagccaagctgaaggctaatctcatg
tgtaagaccgacatcaaatgcagactcgcgaagtccactctgacgctcatcccgcttctg
ggcacgcatgaagtcatctttgcctttgtgatggacgagcacgcccgaggaaccctacgc
ttcgtcaagctgttcacagagctctccttcacttccttccagggctttatggtggctgtc
ttgtactgctttgtcaacaatgaggtccagatggagtttcggaagagctgggagcgctgg
aggctggagcgcttgaacatccagagggacagcagcatgaaacccctcaagtgtcccacc
agcagcgtcagcagtggggccacggtgggcagcagcgtgtatgcagccacctgccaaaat
tcctgcagctga

DBGET integrated database retrieval system