KEGG   Rattus norvegicus (rat): 25054Help
Entry
25054             CDS       T01003                                 

Gene name
Ntrk2, RATTRKB1, TRKB1, Tkrb, trk-B, trkB
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04722  Neurotrophin signaling pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25054 (Ntrk2)
   04010 MAPK signaling pathway
    25054 (Ntrk2)
   04151 PI3K-Akt signaling pathway
    25054 (Ntrk2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25054 (Ntrk2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    25054 (Ntrk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25054 (Ntrk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25054 (Ntrk2)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   25054 (Ntrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT Ig_C17orf99 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 25054
NCBI-ProteinID: NP_036863
RGD: 3213
Ensembl: ENSRNOG00000018839
UniProt: Q63604
Position
17p14
AA seq 821 aa AA seqDB search
MSPWPRWHGPAMARLWGLCLLVLGFWRASLACPMSCKCSTTRIWCTEPSPGIVAFPRLEP
NSIDPENITEILIANQKRLEIINEDDVEAYVGLKNLTIVDSGLKFVAYKAFLKNGNLRHI
NFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNES
SKNTPLANLQIPNCGLPSARLAAPNLTVEEGKSVTISCSVGGDPLPTLYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTD
VADQTNREHLSVYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKGPASVISNDDDSASPL
HHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLK
RELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIV
KFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIA
AGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMP
PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQE
VYELMLGCWQREPHTRKNIKNIHTLLQNLAKASPVYLDILG
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctggccgaggtggcatggacccgccatggcgcggctctggggcttatgcttg
ctggtcttgggcttctggagggcttctcttgcctgccccatgtcctgcaaatgcagcacc
actaggatttggtgtaccgagccttctcctggcatcgtggcatttccgaggttggaacct
aacagcattgacccagagaacatcaccgaaattctcattgcaaaccagaaaaggttagaa
atcatcaatgaagatgatgtcgaagcttacgtggggctgaaaaaccttacaattgtggat
tccggcttaaagtttgtggcttacaaggcgtttctgaagaacggcaacctgcggcacatc
aatttcactcgaaacaagctgacgagtttgtccaggagacatttccgccaccttgacttg
tctgacctgatcctgacgggtaatccgttcacgtgttcctgtgacatcatgtggctcaag
actctccaggagacgaaatccagccccgacactcaggatttgtattgcctcaatgagagc
agcaagaatacccctctggcgaacctgcagattcccaattgtggtctgccgtctgcacgt
ctggccgctcctaacctcacggtggaggaagggaagtctgtgaccatttcctgcagcgtc
gggggtgacccgctccccaccttgtactgggacgttgggaatttggtttccaaacacatg
aatgaaacaagccacacacagggctccttaaggataacaaacatttcatcggatgacagt
gggaaacaaatctcttgtgtggcagaaaacctcgttggagaagatcaagactctgtgaac
ctcactgtgcattttgcaccaaccatcacatttctcgaatctccaacctcagaccaccac
tggtgcatcccattcactgtgagaggcaaccccaagccagcacttcagtggttctacaac
ggagccatactgaatgaatccaagtacatctgtaccaaaatacacgtcaccaatcacacg
gagtaccacggctgcctccagctggataaccccactcatatgaataatggagactacacc
ctaatggccaagaatgaatatgggaaggacgagagacagatttctgctcacttcatgggc
cggcctggagttgactatgagacaaacccaaattaccctgaagtcctctatgaagactgg
accacgccaactgacatcggggatactacaaacaaaagtaatgagatcccctccacggat
gttgctgaccaaaccaatcgggagcatctctcggtctatgccgtggtggtgattgcctct
gtggtaggattctgcctgctggtgatgctgcttctgctcaagttggcgagacattccaag
tttggcatgaaaggcccagcttccgtcatcagcaacgacgatgactctgccagccctctc
caccacatctccaacgggagcaacactccgtcttcttcggagggcgggcccgatgctgtc
atcattgggatgaccaagatccctgtcattgaaaacccccagtacttcggtatcaccaac
agccagctcaagccggacacatttgttcagcacatcaagagacacaacatcgttctgaag
agggagcttggagaaggagcctttgggaaagttttcctagcggagtgctataacctctgc
cccgagcaggataagatcctggtggccgtgaagacgctgaaggacgccagcgacaatgct
cgcaaggactttcatcgcgaagccgagctgctgaccaacctccagcacgagcacattgtc
aagttctacggtgtctgtgtggagggcgacccactcatcatggtctttgagtacatgaag
cacggggacctcaacaagttccttagggcacacgggccagatgcagtgctgatggcagag
ggtaacccgcccaccgagctgacgcagtcgcagatgctgcacatcgctcagcaaatcgca
gcaggcatggtctacctggcatcccaacacttcgtgcaccgagacctggccacccggaac
tgcttggtaggagagaacctgctggtgaaaattggggacttcgggatgtcccgggatgta
tacagcaccgactactaccgggttggtggccacacaatgttgcccatccgatggatgcct
ccagagagcatcatgtacaggaaattcaccaccgagagtgacgtctggagcctgggagtt
gtgttgtgggagatcttcacctacggcaagcagccctggtatcagctatcaaacaacgag
gtgatagaatgcatcacccagggcagagtccttcagcggcctcgcacgtgtccccaggag
gtgtacgagctgatgctgggatgctggcagcgggaaccacacacaaggaagaacatcaag
aacatccacacactccttcagaacttggcgaaggcgtcgcccgtctacctggacatccta
ggctag

DBGET integrated database retrieval system