KEGG   Rattus norvegicus (rat): 25056Help
Entry
25056             CDS       T01003                                 

Gene name
Rbp1
Definition
(RefSeq) retinol binding protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 25056
NCBI-ProteinID: NP_036865
RGD: 3543
Ensembl: ENSRNOG00000013794
UniProt: P02696
Structure
PDB: 

Position
8q31
AA seq 135 aa AA seqDB search
MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRN
YIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM
RAEGVTCKQVFKKVH
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtggacttcaacgggtactggaagatgctgagcaacgagaatttcgaggagtac
ctgcgtgcgctcgatgtcaacgtggccttgcgaaaaatcgccaacttgctgaagccggac
aaagagatcgtgcaggatggcgaccacatgatcatccgcacgctgagcacttttcgaaac
tatatcatggacttccaagttgggaaggagttcgaggaggatctgacaggcatagatgac
cgcaagtgcatgaccacagtgagctgggatggtgacaagcttcagtgtgttcagaaggga
gagaaggagggacgtggctggacccagtggattgagggtgatgaacttcacctggagatg
agagcagagggtgtgacctgcaagcaagtgttcaagaaagtacactga

DBGET integrated database retrieval system