KEGG   Rattus norvegicus (rat): 25066Help
Entry
25066             CDS       T01003                                 

Gene name
PVR, Taa1, Tage4
Definition
(RefSeq) poliovirus receptor
  KO
K06539  poliovirus receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    25066 (PVR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    25066 (PVR)
   04090 CD molecules [BR:rno04090]
    25066 (PVR)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  Necl family
   25066 (PVR)
CD molecules [BR:rno04090]
 Proteins
  25066 (PVR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 ig Ig_3 V-set I-set Ig_2 C1-set PTP_tm
Motif
Other DBs
NCBI-GeneID: 25066
NCBI-ProteinID: NP_058772
RGD: 3813
Ensembl: ENSRNOG00000019202
UniProt: Q5U334
Position
1q21
AA seq 412 aa AA seqDB search
MAPLAGASRSRVWSVGLLRLLLLSCFTLQKAGGEIAVQVLSNSTGFLGGSTVLHCSLASK
DNVTITQLTWMKRDPDGSHPSVAVFHPKKGPSISDPERVKFLVAKVYEDLRNASLAISNL
RVEDEGIYECQIATFPTGSKSANVWLKVFARPKNTAEALEPSPTLMPQDVAKCISADGHP
PGRITWSSNVNGSYREMKETGSQPGTTTVISYLSMVPSSQADGTNITCTVEHESFQEPDQ
QPLILSLPYPPEVSISGYEGNWYIGLTNVNLTCEARSKPPPTNYSWSTATGPLPNSTHFQ
ENGSHLLISTVDDLNNTIFVCKAINALGSGQGQVTILVKEASEILPPKTSLGTGYIIAIV
FCVLIIGVVAGIVFWKYRRGCGRQSRTLDRENVRYSAANGVSVPNVETNNLR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccccactcgccggtgcctctcgctcccgggtgtggtcagtggggctactgaggctg
ctgctgctgtcctgctttacgctccagaaagcgggtggggagatagctgtgcaggtgctc
tccaattcgaccggcttcttgggagggtctacagtcttgcactgtagtctggcttccaaa
gacaatgtgacaatcactcagctaacatggatgaagagggatccagatggatcccaccct
tccgtggctgtcttccaccccaagaaggggcccagcatctctgatccagagagggtgaag
ttcttggttgccaaggtgtacgaggatctgaggaacgcatctctggccatctcgaacttg
cgtgtagaagacgaaggcatctatgagtgtcagattgccacgttccccacaggcagtaag
agcgccaatgtctggctgaaggtgttcgcccgacctaaaaacacagcagaggccctggag
ccctctcccaccttgatgccgcaggacgtggccaaatgcatctctgctgatggtcaccct
cctggacgaatcacgtggtcctcgaatgtgaatggaagctaccgtgaaatgaaggaaaca
gggtcccagccgggcaccaccacagttatcagctacctctccatggtgccttctagccag
gcagatggcacgaacatcacctgcacagtggaacatgaaagcttccaggagccggaccag
cagccattgatcctttccctaccttatccacccgaagtgtccatctctggctatgaaggc
aactggtacattggcctcactaacgtgaacctgacctgtgaagctcgcagcaaaccaccg
cccaccaactatagctggagcacggccacgggtccccttcccaactccactcatttccag
gaaaacggcagtcacctgctaatctccaccgtggatgacctcaataacacgatctttgtg
tgcaaagccatcaatgccctagggtctgggcagggccaagtgaccatcctagttaaagag
gcatctgagattctgccgccaaagacaagcttaggcactggctacatcattgccatcgtc
ttttgtgtcctgatcatcggagtagtagcaggcattgtattctggaaatacaggcgtggt
tgtggtcggcagtccaggaccttagacagggagaacgtccgctattcagcagcgaatggc
gtctctgtcccaaacgtggagacgaacaacttgaggtga

DBGET integrated database retrieval system