KEGG   Rattus norvegicus (rat): 25073
Entry
25073             CDS       T01003                                 

Gene name
Scarb1
Definition
(RefSeq) scavenger receptor class B member 1
  KO
K13885  scavenger receptor class B, member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04913  Ovarian steroidogenesis
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
rno04975  Fat digestion and absorption
rno04976  Bile secretion
rno04977  Vitamin digestion and absorption
rno04979  Cholesterol metabolism
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    25073 (Scarb1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25073 (Scarb1)
   04925 Aldosterone synthesis and secretion
    25073 (Scarb1)
   04927 Cortisol synthesis and secretion
    25073 (Scarb1)
  09154 Digestive system
   04976 Bile secretion
    25073 (Scarb1)
   04975 Fat digestion and absorption
    25073 (Scarb1)
   04979 Cholesterol metabolism
    25073 (Scarb1)
   04977 Vitamin digestion and absorption
    25073 (Scarb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    25073 (Scarb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25073 (Scarb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25073 (Scarb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25073 (Scarb1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    25073 (Scarb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25073 (Scarb1)
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 25073
NCBI-ProteinID: NP_113729
RGD: 2302
Ensembl: ENSRNOG00000000981
UniProt: P97943
Position
12
AA seq 509 aa
MGVSSRARWVALGLGVLGLLCAALGVIMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIP
VPFYLSVYFFEVVNPSEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSYIENRSLR
FQPDRSQGSESDYIVLPNILVLGGAVMMEDKPTSLKLLMTLGLVTMGQRAFMNRTVGEIL
WGYEDPFVNFLSKYFPDMFPIKGKFGLFVGMNDSSSGVFTVFTGVQNFSKIHLVDKWNGL
SEVNYWHSEQCNMINGTAGQMWAPFMTPESSLEFFSPEACRSMKLTYQESRVFEGIPTYR
FTAPDTLFANGSVYPPNEGFCPCRESGIQNVSTCRFGAPLFLSQPHFYNADPVLSEAVLG
LNPDPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGVGQTGKIEPVVLPLLWFEQSG
MMGGKTLNTFYTQLVLMPQVLHYAQYVLLGLGGLLLLVPIIYQLRSQEKCFLFWSGSKKG
SQDKEAMQAYSESLMSPAAKGTVLQEAKL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggcgtcagctccagggcacgctgggtggccttggggctgggcgttctagggctgctg
tgtgctgcgctcggcgttatcatgattctcatggtgccctcgctcatcaagcagcaggtg
ctcaagaatgtccgcatagaccccagcagcctgtcctttgggatgtggaaggagatccct
gttcccttctacttgtccgtctacttcttcgaggtggtcaaccccagcgaggtcctaaat
ggccagaagccagtagtccgggagcgcggaccctatgtctacagggagttcagacaaaag
gttaacatcaccttcaatgacaatgacacggtgtcctacatagagaaccgaagccttcgt
ttccagccagacaggtcccagggctcagagagtgactacattgtactgcctaacatcctg
gtcctgggaggggcagtgatgatggaggacaagcccacaagcctgaagctgctaatgacc
ttggggttggtcaccatgggccagcgggcctttatgaaccgcacggttggtgagatcctg
tggggctacgaagatccctttgtgaatttcctcagcaaatatttcccagacatgttcccc
atcaaaggcaaatttggcctgttcgttgggatgaacgactcgagttctggcgtcttcacc
gtcttcacaggtgtccagaatttcagcaagatccatctggtggataagtggaacggcctc
agcgaggtcaactattggcattcggaacagtgcaacatgatcaatggtactgccgggcag
atgtgggcaccattcatgacacccgaatcctcactggaattcttcagcccagaagcctgc
agatctatgaagctcacctaccaggaatcaagggtgttcgaaggcatccccacttatcgc
ttcacggcccccgatactttgtttgccaacgggtccgtctacccacctaatgaaggcttc
tgcccgtgccgcgagtccggcattcagaatgtcagcacctgcaggtttggtgcgcccctg
tttctctcccagccccacttctacaatgctgaccccgtgctgtcagaagctgttcttggt
ctgaaccctgacccaaaggagcattccttgttcctagacatccacccggtcactgggatc
cccatgaactgttccgtgaagatgcagctgagtctgtacatcaaatccgtcaagggcgtc
gggcaaacagggaagatcgagccagtagtcctgccattgctgtggttcgaacagagcggg
atgatgggtggcaagaccctgaacacgttctacacgcagctggtgctgatgccccaggtt
cttcactacgcgcagtatgtgctgctggggcttggaggcctcctgcttctggtgcccatc
atttaccaactgcgcagccaggagaaatgctttttattttggagtggtagtaaaaagggc
tcgcaggataaggaggccatgcaggcctactctgagtctctgatgtcaccagctgccaag
ggcacggtactgcaagaagccaagctgtag

DBGET integrated database retrieval system